KEGG   Sinorhizobium fredii NGR234: NGR_c18070Help
Entry
NGR_c18070        CDS       T00888                                 

Definition
(RefSeq) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00061  Fatty acid biosynthesis
rhi00780  Biotin metabolism
rhi01100  Metabolic pathways
rhi01212  Fatty acid metabolism
Module
rhi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NGR_c18070
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NGR_c18070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rhi01004]
    NGR_c18070
Enzymes [BR:rhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     NGR_c18070
Lipid biosynthesis proteins [BR:rhi01004]
 Fatty acid synthase
  Component type
   NGR_c18070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-GeneID: 7791086
NCBI-ProteinID: YP_002826324
RhizoBase: NGR_c18070
UniProt: C3MDQ2
LinkDB All DBs
Position
complement(1865573..1866049)
Genome map
AA seq 158 aa AA seqDB search
MLLEYFQMIDRIETVDLAAGRLTARSVVPEKSPVFEGHFPGYPLVPGVLLIETMAQASGF
LVLAATKFVAMPFLMSVDGAKMRTFVEPSAELEIEAFLEHEGSGFAVTKARINSGGKKIC
DAQLKLRTMPFDQVPLGEIVRKRADEVGLMAATAASEK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgctccttgaatatttccagatgatcgaccggatcgaaacggtcgatctcgcggcgggc
cggctgacggctcggtccgtcgttccggagaaaagcccggtgttcgaggggcatttcccg
ggctatccgctggttcccggcgtgctcttgatcgagacgatggcgcaggcctccggcttt
ctcgtgcttgccgccacgaaattcgtggcaatgcccttcctgatgtcggtcgacggcgcc
aagatgcgcaccttcgtcgagccttcagccgagctcgaaatcgaagcatttctcgagcac
gagggctcgggcttcgcggtcaccaaggccaggatcaactcgggcggcaagaagatctgc
gacgcccagctcaagctcaggacgatgccattcgatcaggtgccgctcggcgagatcgtc
cgcaagcgggccgacgaagtgggattgatggccgcgacggccgcttcggagaagtaa

DBGET integrated database retrieval system