KEGG   Sinorhizobium fredii NGR234: NGR_c21040Help
Entry
NGR_c21040        CDS       T00888                                 

Gene name
ddl
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00473  D-Alanine metabolism
rhi00550  Peptidoglycan biosynthesis
rhi01100  Metabolic pathways
rhi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NGR_c21040 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NGR_c21040 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    NGR_c21040 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rhi01011]
    NGR_c21040 (ddl)
Enzymes [BR:rhi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NGR_c21040 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:rhi01011]
 Precursor biosynthesis
  Amino acid ligase
   NGR_c21040 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 GARS_A ATPgrasp_ST ATP-grasp
Motif
Other DBs
NCBI-GeneID: 7791382
NCBI-ProteinID: YP_002826620
RhizoBase: NGR_c21040
UniProt: C3MEM6
LinkDB All DBs
Position
complement(2165542..2166462)
Genome map
AA seq 306 aa AA seqDB search
MSGKHVAVLMGGFSSERPVSLSSGAACADALEAEGYRVSRVDVGRDVAAVLADLRPDIVF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMDKAQAKHVAKAAGIPVADALIMDR
REFGNAHPMKPPYVVKPVREGSSFGVVIVKEDQSHPPQVITSSEWRYGDRVMVERYIAGR
ELTCGVMGDVALGVTEIIPQGHAFYDYDSKYVKGGSAHVIPAQISPNIYQKIQSLAVKAH
QAIGCRGVSRSDFRFDDRGEGELIWLEINTQPGMTPTSLVPEMAQHAGLQFGEFLRWMVE
DASCLR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaagcatgttgctgtcctgatgggcggattttcctcggagcggccggtgagc
ctgtcttccggggcagcttgcgcggatgccttggaggccgagggctatcgcgtcagccgg
gtcgatgtcggccgggatgtggctgccgtgctcgccgatttgcgtccggatattgtcttc
aacgccctgcacgggccgttcggcgaggacgggacgatccagggcattctggaatatttg
gagattccctacacccattccggcgtgctcgcctcggcgcttgcgatggacaaggcgcag
gccaagcacgttgccaaggcggctggcatcccggttgccgacgcgttgatcatggatcgc
cgcgagttcggcaatgcccatccgatgaagccgccttatgtcgtgaagccggtccgcgag
ggatcgagcttcggcgtcgtcatcgtcaaggaagaccagtcgcatccgccgcaggtcatt
acctccagcgaatggcgctacggcgaccgcgtcatggtcgagcgctacattgccggccgc
gaactcacctgtggcgtcatgggtgacgtggcgctcggcgtcaccgagatcatcccgcag
gggcatgccttctacgactatgattccaaatacgtaaaaggtggttcggcgcacgtcatt
ccggcgcagatttcaccaaatatttaccaaaaaatacaatcattggcggtgaaggcgcat
caggcgatcggttgccgcggcgtcagtcgatccgacttccgtttcgatgatcgtggcgag
ggcgagttgatctggctggagatcaatacgcagcccggcatgaccccgacctccctggtg
cccgaaatggcgcagcatgcgggccttcagtttggtgagtttctaagatggatggtggag
gacgcatcgtgcttgcgttga

DBGET integrated database retrieval system