KEGG   Sinorhizobium fredii NGR234: NGR_c23150Help
Entry
NGR_c23150        CDS       T00888                                 

Definition
(RefSeq) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00010  Glycolysis / Gluconeogenesis
rhi00620  Pyruvate metabolism
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGR_c23150
   00620 Pyruvate metabolism
    NGR_c23150
Enzymes [BR:rhi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     NGR_c23150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 7789971
NCBI-ProteinID: YP_002826827
RhizoBase: NGR_c23150
UniProt: C3MFL7
LinkDB All DBs
Position
complement(2402003..2403511)
Genome map
AA seq 502 aa AA seqDB search
MLHQKILDNPFKHKYGNFIGGEWREPVAGRYFDNTTPVTGGSLCQIARSDAADIELALDA
AHAAKEKWGRTSTTERSNILMKIAARMEDNLELLARAETWDNGKPIRETMAADIPLAIDH
FRYFAACIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKVAPALAAGNC
VVLKPAEQTPASILILAELIADLLPPGVLNIVNGFGLEAGKPLATSPRIAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVLNEDDDYFDKALEGFAMFALNQGEVCTCP
SRALVQESIYDRFMERAVKRVEAIRQGNPLDSATMIGAQASGEQLEKILSYIDIGKQEGA
EVLAGGGRNVLEGDLAGGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKTEDEALEIAN
DTLYGLGAGVWSRDANRCYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcagaaaattctcgataacccgttcaagcacaagtatggaaatttcatcggc
ggtgaatggcgcgagccggtcgccggccgctatttcgacaataccacgcctgtcaccggc
ggttcgctctgccagatagcccgatcggatgccgccgatatcgagctcgcactcgatgct
gcccatgccgccaaggagaagtggggccgcacctcgaccaccgagcgctccaacatcctg
atgaagatcgccgcgcggatggaggacaatctcgaacttctggcgcgggccgagacctgg
gacaacggcaaaccgatccgcgaaaccatggccgccgatattccgctggcgatcgaccat
ttccgctatttcgccgcctgcatccgggcacaggaaggctcgatcggcgagatcgaccac
gatacggtcgcctaccatttccatgagccgctcggtgtcgtcggccagatcattccgtgg
aacttcccgatcctgatggccgcctggaaggtggcgccggcccttgccgccggcaactgc
gtcgtcctgaagccagccgagcagacgccggcctcgatcctcatcctcgccgaattgatc
gccgacctgttgccgccgggcgtgctcaacatcgtcaacggcttcgggctcgaagcgggc
aagccgctggcgaccagcccgcgcatcgccaagatcgcctttaccggggagacgacgacg
gggcggctgatcatgcaatatgccagccaaaacctcatccccgtcacactcgagctcggc
ggcaagtcgccgaacatcttcttcgccgacgtgctcaatgaggacgacgactatttcgac
aaagcgctcgaaggcttcgcgatgttcgcgctcaaccagggcgaggtctgcacctgcccg
agccgggcgctggtccaggaaagcatctatgatcgcttcatggagcgggcggtgaagcgg
gtcgaggcgatccggcagggcaatccgctcgacagtgcaacgatgatcggcgcgcaggcg
tcgggcgaacagttggagaagatcctctcctatatcgacatcggcaagcaggaaggcgcc
gaggtcctggccggcggcgggcgcaacgtgctcgagggcgacctcgccggtggctactac
gtcaagccgacggtgttccgtgggcacaacaagatgcggatcttccaggaggaaatcttc
ggaccggtcgtgtcggtgaccaccttcaagaccgaggacgaggcgctcgagatcgccaat
gacacgctctacggcctcggtgccggcgtgtggagccgcgacgccaatcgctgctaccgc
ttcggccgcgaaatccaggccggccgcgtctggaccaattgctaccatgcctacccggcg
catgccgccttcggcggctacaagcaatcgggcatcggccgcgagacgcacaagatgatg
ctcgaccattaccagcagaccaagaacatgctggtgagctacagcccgaaggcgctcggc
ttcttctga

DBGET integrated database retrieval system