KEGG   Sinorhizobium fredii NGR234: NGR_c23630Help
Entry
NGR_c23630        CDS       T00888                                 

Gene name
tdk
Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00240  Pyrimidine metabolism
rhi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    NGR_c23630 (tdk)
Enzymes [BR:rhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     NGR_c23630 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 KdpD
Motif
Other DBs
NCBI-GeneID: 7790019
NCBI-ProteinID: YP_002826875
RhizoBase: NGR_c23630
UniProt: C3MFR5
LinkDB All DBs
Position
complement(2458257..2458841)
Genome map
AA seq 194 aa AA seqDB search
MAKLYFSYATMNAGKSTLLLQAAYNYQERGMRVVMLIAAFDDRAGTGRIASRIGLKSDGI
PFHGGDDLYGLVERLNGDGSGEIACVFVDEAQFLGENQVWQLARVADRLGIPVMAYGLRT
DFQGKLFPGSMALLAIADEMREVRTICHCGRKATMVVRLDGAGHVVREGAQVDVGGNEKY
VSYCRRHWEDQMRG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttcagctatgcgacgatgaatgccggcaagagcacgctgctcctc
caggccgcctacaactatcaggagcgcggcatgcgcgtcgtgatgctgatcgccgccttc
gacgatcgggccggcacgggacgaatcgcgtcgcgcatcgggcttaaatcggacgggata
ccgttccatggcggcgacgatctttacggccttgtcgagcgcctgaacggcgacggctcc
ggcgagatcgcctgcgttttcgtcgacgaggcgcaattcctcggcgagaaccaggtgtgg
cagcttgcgcgcgtcgccgaccggctcggcattccggtcatggcctatggcctcaggacc
gactttcagggaaaactctttcccggctccatggccctgcttgcgattgccgacgaaatg
cgcgaggtcaggacgatctgccattgcggacgcaaggcgacgatggtggtgcgcctcgac
ggcgccggccatgtcgtgcgcgagggcgcgcaggtcgatgtcggcggcaatgagaaatac
gtgtcctactgccggcggcattgggaagaccagatgcgcggctga

DBGET integrated database retrieval system