KEGG   Sinorhizobium fredii NGR234: NGR_c30940Help
Entry
NGR_c30940        CDS       T00888                                 

Gene name
glpD
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00564  Glycerophospholipid metabolism
rhi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NGR_c30940 (glpD)
Enzymes [BR:rhi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NGR_c30940 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_3 Pyr_redox_2 K_oxygenase NAD_binding_8 DUF627 GIDA
Motif
Other DBs
NCBI-GeneID: 7792365
NCBI-ProteinID: YP_002827582
RhizoBase: NGR_c30940
UniProt: C3M9Q4
LinkDB All DBs
Position
3250935..3252452
Genome map
AA seq 505 aa AA seqDB search
MSEQAIFDVFVIGGGINGCGIARDAVGRGYSVALAEMDDFASGTSSGSTKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPMRFVLPYHKGGPRPAWLIRLGLFLYDHIGGRKL
LPATSTLDMTRDAAGGPLKRLFTKAFEYSDGWVDDARLVVLNARDAADRGARIMARTRVV
SARRENGRWAIETEDAQTGARETLRARLLVNATGPWVDRVLADTLGKNDVHNVRLVQGSH
IVVKRKFDDPRAYFFQNPDGRIMFAIPYQNDFTLIGTTDRDFTGNPADVRISDAEIDYLC
KSASEYFSDPVTTDDIVWTYSAVRPLYDDGASKAQEATRDYVLRVEGQNGQAPLLNVFGG
KLTTYRRLAESALEKIGEAIGTKGSKWTATSHLPGGDFAATAYDTEVDMLKARYPFLALS
HARRLVRLYGTQAASLLGHAASQADLGKHFGTDLYEVEVDWLIGQEWARRAEDVLWRRTK
LGLKLTPAEIAELEDYMRGAVNAAA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagcaggcaatcttcgacgtctttgtcataggcggcggcatcaacggatgcggc
attgcgcgtgatgcggtcggccggggctattccgtcgcgctggccgaaatggacgatttc
gcctccggcacctcctccggttccaccaagctcatccatggcggcctgcgctatctcgag
cattacgaattccggctggtgcgcgaggcgctgatggagcgcgaggtgctctgggcgatg
gcgccgcacgtcatctggccgatgcgcttcgtcctgccctatcacaagggcggcccgcgc
ccggcctggcttatccgtcttggcctcttcctctacgaccatatcggcggccgcaagctg
ttgccggcgacgagcacgctggacatgacccgcgacgccgcgggcgggccgctgaagcgt
ctcttcaccaaggccttcgaatattccgacggctgggtcgacgacgcccgcctcgtcgtg
ctgaacgcccgcgatgccgccgatcgcggcgcccggatcatggcgcgtacccgcgtcgtc
tcggcgcggcgcgaaaacggtcgctgggcgatcgaaaccgaggacgcccagaccggtgca
cgcgaaacccttcgcgctcgcctgctcgtcaacgccaccggcccctgggtcgaccgcgtg
ctcgccgatacactcggcaagaacgatgttcacaatgtccgcctcgtccagggcagccat
atcgtcgtgaagaggaaattcgacgacccgcgcgcctatttcttccagaatccggacgga
cggatcatgttcgccatcccttaccaaaacgacttcactctgatcggcaccaccgaccgg
gatttcaccggcaatcccgcggatgtgcgcatcagcgatgccgagatcgactatctctgc
aaatcggcgagcgaatatttcagcgatccggtcaccacggacgatatcgtctggacctat
tcggcggtccgcccgctctatgacgacggggcaagcaaggcgcaggaggcgacccgcgac
tatgtgctgcgcgtcgagggacagaacggccaggcgccgcttctcaatgtctttggcggc
aagctcacgacctatcggcggctcgccgaatcggcgcttgaaaagatcggcgaggcgatc
gggaccaagggcagtaaatggacggccacgtcccacctgccgggcggcgactttgcggca
accgcctacgataccgaagtcgacatgctgaaggcgcgctacccctttctcgcgctttcg
catgcccgccggctggtccggctctacggcacccaggctgcaagtctgcttggccatgcg
gcgagccaggcggacctcggcaagcacttcggcactgatctttacgaggtcgaagtggac
tggctgatcggacaggaatgggcgcggcgcgccgaggacgtgctctggcgccgcacgaaa
ctgggattgaagctgacgccggcggagatcgcggagttggaggactacatgcgcggcgcc
gtcaacgccgcagcatag

DBGET integrated database retrieval system