KEGG   Rhizobium sp. Kim5: Kim5_CH02147Help
Entry
Kim5_CH02147      CDS       T05501                                 

Definition
(GenBank) xylose isomerase domain-containing protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
rhk  Rhizobium sp. Kim5
Pathway
rhk00040  Pentose and glucuronate interconversions
rhk00051  Fructose and mannose metabolism
rhk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Kim5_CH02147
   00051 Fructose and mannose metabolism
    Kim5_CH02147
Enzymes [BR:rhk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Kim5_CH02147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ARQ58201
LinkDB All DBs
Position
2147253..2148242
Genome map
AA seq 329 aa AA seqDB search
MSETRFATRLNSFASGAHLAWPGQSGKPSVLQMAERAARVQGLTDLDLNYPDHVNDNPAE
LARKFGDFGLSINGFAMRYYTNPDFKLGAFTHPEEAVRREAINLTKKGIDAAREAGANLM
TIWLGQDGFDYAFQADYARLWQHEIDGIREVCQHDPDCLISIEYKPNEPRSYSLLPDAAT
TLLAIKEVGAGNLGVTLDFAHVLYADEQPAFAAALIARHSRVLGVHLNDGYAKRDDGLMV
GAVHSLQTIELLRQIRRDGYDGAIYFDTFPDLTGLDPVRECEVNIKTVRRMLRVVDRLEQ
DNRLSSAIDRQDALSTLAIVQELMLGADH
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgagacacgttttgccacacgattgaattccttcgcctctggtgcgcacctcgcc
tggcccgggcagtctggaaagccgtccgtcctgcagatggcggagcgtgcggctcgcgtg
caaggattgaccgacctcgacctgaattaccccgatcacgtgaacgacaatccggctgag
ttggcccggaagtttggcgatttcggcctgtcgatcaatggcttcgcgatgcgctactac
accaatccggatttcaagctcggcgccttcacacatccggaggaagcggttcgccgcgaa
gcgatcaatctgacgaagaaaggcatcgacgcagcgcgcgaggccggcgcgaacctgatg
accatctggctcgggcaggatggcttcgattacgctttccaggccgattatgctcggttg
tggcaacacgaaatcgacggaatccgtgaagtttgtcaacatgacccggattgcctgatc
tccatcgaatacaagccgaacgagccgcgctcctacagcctgctgcctgatgccgcgaca
acgctgctcgccatcaaggaagtgggggccgggaatctcggcgtgacgcttgatttcgcc
catgtcctctatgccgacgaacaacccgccttcgcggcggccctgatcgcacgtcacagc
cgggttctcggcgtccatctgaatgatggctacgccaagcgcgacgacgggctgatggtc
ggcgccgttcattcgctgcagaccatcgagttgctccgccagattcgccgggatggctat
gacggcgcgatctatttcgacacgttccccgatctgaccggtctcgacccggtccgcgaa
tgcgaggtcaacatcaagaccgtccgacggatgttgagggtcgtcgaccgcctcgagcag
gacaaccgcctatcgagcgcgattgaccgacaggacgccctttccacgctggccattgta
caggagttgatgctcggcgcggaccactga

DBGET integrated database retrieval system