KEGG   Rhizobium sp. Kim5: Kim5_CH03350Help
Entry
Kim5_CH03350      CDS       T05501                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rhk  Rhizobium sp. Kim5
Pathway
rhk00240  Pyrimidine metabolism
rhk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Kim5_CH03350 (tdk)
Enzymes [BR:rhk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Kim5_CH03350 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ARQ59375
LinkDB All DBs
Position
complement(3355969..3356571)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTLLLQASYNYQERGMRTVQLIAAFDERAGRGVIGSRIGLEASAI
PFEPHEDLFKLIAGLCGDGAPISCVFVDEAHFMTAVHVWQLARVVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAHGKVLHEGAQIDVGGNEKYV
SLCRRHWDDEMNGAWIAEPV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaactattcgacgatgaacgccggcaagtcgacgctgctgctg
caggcctcctacaattatcaggagcgcggcatgcgtacggtgcagctgattgcggccttc
gacgagcgcgccggccggggcgtcatcggctcgaggatcgggctggaagcgagcgccatc
cccttcgagccgcacgaagatctgttcaagctcatcgccggactgtgcggcgacggggcg
ccgatttcctgcgtcttcgtcgacgaggcgcatttcatgacggccgtccatgtctggcag
cttgcccgtgtcgtcgatcggctcggcatccctgtcatggtctatgggctccggaccgac
ttccagggcaaactgtttccggcttcgcaggagttgctggcgatcgctgacgagatgcgc
gaagtgcgcacgatctgccattgcggccgtaaggcgacgatggttgtgcggctcgacgcc
cacggcaaggtgctgcacgagggcgcgcagatcgatgtcggcggtaacgagaaatatgtc
tcgctctgccgcaggcactgggacgacgaaatgaacggcgcctggatcgcggagccggtc
tga

DBGET integrated database retrieval system