KEGG   Rhizobium sp. Kim5: Kim5_PC00450Help
Entry
Kim5_PC00450      CDS       T05501                                 

Definition
(GenBank) glycosyde hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
rhk  Rhizobium sp. Kim5
Pathway
rhk00500  Starch and sucrose metabolism
rhk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Kim5_PC00450
Enzymes [BR:rhk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Kim5_PC00450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ARQ61861
LinkDB All DBs
Position
pRetKim5c:480007..481434
Genome map
AA seq 475 aa AA seqDB search
MTVALWSQSMTGANPAHIGANAPTVKPRPAFAQTDLVALSRYFSLLMMRNITSDGYVIED
PTSPGVFSAPGCVIAAPSYPANTPGVDQDYVFNWVRDGAITAIEIALAGLLPVPGGVLPS
LVDYVNFAALCQANAENSDTVTLGHACFTITGEVRPWSEQNDGPAIQSIAILTLFDQLDG
ATQTIAKQLVQANLAYLLEVYQNKTTNLWEEYEGYSFFARAVQLRFFREISTNTIGIAVP
AGVSDAISWLETQLVTHWNGQLYVSILDAAEQAGYDANIDIVSSVCYGGIEPTDTKLLAT
AAILRRQWADPSSSTYYPVNGADAANGLGPLFGRYPGDHYDGDVAAPVAGGHPWALCTAN
FAEFQYRLANAIDASGAIPLDQFSEPFFAGLGLGASSSAADASAALRASSDAMLRAIVYH
SDHYELSEQFDGTVGYEKSVRNLTWSYASFLSAVRARAAAPAAKSKPRNSRGPKS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgcgctttggagtcagtcaatgacgggtgcgaacccggcccatatcggcgcc
aatgcgcctacggtcaaaccacggcctgccttcgcgcagaccgatctggtcgcattgtcg
cgctatttttctcttctgatgatgcgcaacatcaccagcgatggctatgtcatcgaggat
cccacatcgcccggcgtcttttcggccccgggctgcgtcatcgccgcaccctcctatcca
gcgaacacgcccggggtggaccaggactatgttttcaactgggttcgcgacggggcgatt
actgcgatagagatcgcgcttgccggcttgctgcccgttccgggcggagtattgccaagc
ctggtcgactacgtgaacttcgccgcgctctgccaggcgaatgcggagaattccgacacc
gtcacacttggccacgcctgcttcaccatcaccggcgaggttcgtccgtggtcggagcag
aatgacgggccggccattcagtcgattgcgatcctgaccctgttcgatcagctggatggc
gccacgcagacgatcgccaaacaactggtccaggccaacctcgcttatcttctcgaagtt
taccagaacaagaccacaaatctctgggaggaatatgagggctattcgtttttcgcaaga
gccgtacagctgcgctttttccgcgaaatttccacaaacacgatcggcattgcggtgcct
gccggggtgtcggatgccatctcctggctggaaacccagctggtaacccactggaacggg
caactctatgtgagcattctggatgccgcggagcaagccggttacgacgcgaacatcgat
atcgtctcttcggtctgctatggcgggatcgagccaaccgataccaagcttctggcaacg
gcggccatcctgcggcgccagtgggccgatccttcgtcttcgacctattacccggtcaat
ggcgccgacgcggccaacgggctcggaccactcttcgggcgctatccgggcgaccattac
gatggcgatgtggcagctccggttgccggcggacatccctgggctctgtgcaccgccaac
ttcgccgagtttcaatatcggcttgccaatgccatcgatgccagcggcgccatccccctc
gatcagttctccgaacccttcttcgcgggactgggacttggcgcatccagcagcgccgcc
gacgcgtcggctgccttgcgggcttcgtctgacgccatgctgcgcgccatcgtctatcac
agcgatcactatgagctgagcgaacagttcgatggaaccgttggctacgagaaaagcgtc
cggaatctgacctggagctatgcctccttcctctcggcagtcagagcccgcgccgccgcg
ccggccgccaagtccaagccccgaaactctcgcggcccgaaatcatga

DBGET integrated database retrieval system