KEGG   Rhizobium sp. Kim5: Kim5_PC00462Help
Entry
Kim5_PC00462      CDS       T05501                                 

Gene name
nrtB
Definition
(GenBank) nitrate ABC transporter permease protein NrtB
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
rhk  Rhizobium sp. Kim5
Pathway
rhk00910  Nitrogen metabolism
rhk02010  ABC transporters
Module
rhk_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:rhk00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Kim5_PC00462 (nrtB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Kim5_PC00462 (nrtB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhk02000]
    Kim5_PC00462 (nrtB)
Transporters [BR:rhk02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Kim5_PC00462 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ARQ61873
LinkDB All DBs
Position
pRetKim5c:495817..496710
Genome map
AA seq 297 aa AA seqDB search
MSALANKENPSIVASAKPAAKILSFSGKQGSRIDFRRAALTALHNVAPPAVVLALVLILW
QALCSSADASLPSPHQVWQDSYDLIVYPFFNYGSQDIGLGWRVLVSLQRVAYGFGLAAVT
GIIIGAIIGQSVWAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDSNPSAIFVIFITSIWPV
IINTAVGVRNIPQDYRNVAEVLRLNQLEFFWKIMLPSAAPYIFTGLRIGVGLSWLAIVAA
EMLTGGVGIGFFIWDAWNSSRLSDIIVALAYIGIVGFALDKLVAALGKLVTRGAMAN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccctggcaaataaagaaaatccctcgatcgtcgcgtctgccaagccggcggcg
aagattctgtcattctccggcaaacaaggatcgcggatcgattttcgccgtgcggcgctg
accgcacttcacaatgtcgctccaccggccgtcgtgctggcactcgtcctcattctctgg
caggcgctctgttcatcggcggatgcctctctgccgtcgccgcatcaagtctggcaggat
agctacgacctcatcgtctatccgttcttcaactacggttcccaggatatcgggctcggc
tggcgggtgctggtctcgctgcagcgcgtggcttatggcttcggccttgccgcagtcacc
ggcatcatcatcggggcgatcatcggccaatcggtctgggcgatgcgcggcctcgatccg
attttccaggtgctacgcacggtgccgccgctcgcctggctgccgctgtcgctcgccgcc
ttccaggattccaacccttcggccatcttcgtcatcttcatcacctcgatctggcctgtc
atcatcaacaccgccgtcggcgtccgcaatattccgcaggattatcgcaacgtcgccgag
gtgctgcggctcaaccaactcgaattcttctggaagatcatgctgccgtcggcagcccct
tacatcttcaccggcctcaggatcggcgtcggcctgtcctggctcgccatcgtcgcggcc
gaaatgctgaccggcggcgtcggcatcggcttcttcatctgggacgcgtggaactcatcg
cgcctttcggacatcatcgtcgcgctcgcctatatcggcatcgtcggttttgccctcgac
aagctggtggccgcgctcggcaaactcgtcacccgcggcgccatggccaactga

DBGET integrated database retrieval system