KEGG   Rhizobium sp. Kim5: Kim5_PC00490Help
Entry
Kim5_PC00490      CDS       T05501                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K02058  simple sugar transport system substrate-binding protein
Organism
rhk  Rhizobium sp. Kim5
Brite
KEGG Orthology (KO) [BR:rhk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhk02000]
    Kim5_PC00490
Transporters [BR:rhk02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter
    Kim5_PC00490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ARQ61901
LinkDB All DBs
Position
pRetKim5c:complement(527687..528634)
Genome map
AA seq 315 aa AA seqDB search
MKSGLKSLFAGAAVAVAFMCSSAIVNAADIRIVAVTHGQANDPFWSVVKNGVNAAAKDIG
VSVDYRAPETFDMVSMGQLIDAAINQKPDGLIVSIPDSSALGPSIKKAVAAGIPVISINS
GSDVSKELGALLHVGQDEYTAGKAAGAKLHELGGKEGLCVNQEVGNVALDLRCKGFADGF
GGKVTVLPVSNDPADVRAKVKAALSSNTAVDTVMALGAGTAGEPSLAAVEDVGMTGKIRV
ATFDLSADFLKAVADGKAAFAIDQQQFLQGYLPVVFLANYAKYGLIPGGNVPSGPNLITK
EKAAQVVDLSAKGIR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctggtttgaaatcgcttttcgcgggcgctgccgtcgctgttgcattcatgtgt
tcttcagcaatcgtcaatgcggcggacattcgcatcgttgccgttacccatggccaggcc
aatgacccgttctggtccgtggtcaagaacggcgtcaacgcagctgcgaaggatatcggc
gtcagcgtcgactatcgggcgccggaaacattcgacatggtgtcgatgggccaactcatc
gatgcggccatcaatcagaaacctgacgggctgatcgtctccatcccggactcttcggcg
ctcggtccgtccatcaagaaggccgtggccgctggcattccggttatctcgatcaactcc
ggttccgacgtatcgaaggaattgggggcgcttctgcatgtcggccaggacgaatacacc
gccggcaaggccgctggcgcgaagctgcatgagctgggcggtaaggaaggcttgtgcgtc
aatcaggaggtcggcaatgtcgcgctcgatctgcgctgcaagggctttgccgacggtttt
ggcggcaaggtcacggttctgcccgtcagcaacgatcctgccgacgtccgggccaaggtc
aaggcggcgctgagctcgaacaccgctgtcgataccgtcatggcgctcggtgccggcacc
gccggcgagccgtctctggcggctgtcgaggatgtcggaatgaccggcaagatccgcgtg
gcgaccttcgacctttcggccgatttcctgaaggccgtggccgacggcaaggcagccttc
gcgattgatcagcagcagttcctgcagggttatctgccggtcgtgtttttggcgaattac
gccaaatacgggctgatcccaggcggcaacgttccgtccggtccgaacctgatcaccaag
gaaaaggccgcccaggtcgtcgatctttccgccaagggcattcgctga

DBGET integrated database retrieval system