KEGG   Rhizobium sp. Kim5: Kim5_PD00304Help
Entry
Kim5_PD00304      CDS       T05501                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rhk  Rhizobium sp. Kim5
Pathway
rhk00564  Glycerophospholipid metabolism
rhk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rhk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Kim5_PD00304 (glpD)
Enzymes [BR:rhk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Kim5_PD00304 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ARQ62309
LinkDB All DBs
Position
pRetKim5d:307927..309441
Genome map
AA seq 504 aa AA seqDB search
MGREIHDIFVIGGGINGCGIARDAVGRGYTVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREILWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PATSVLDMRKDPAGKPLKALFTRAFEYSDGWVDDARMVVLNARDAADKGATILPRTKVVS
ARRESGLWHIETVDTVTGRKDGHQARMLVNAAGPWVDHVIRSAFGQKEAHNVRLVQGSHI
VVKKKFDDPRAYFFQNPDNRIIFAIPYEGDFTLIGTTDRDYTADPKDVRISEEETVYLCN
AASEYFKEPVRPEDIVWTYSAVRPLYDDGASKAQEATRDYVLKLDGERETAPLLNVFGGK
LTTYRRLSEHALEKIGAAIGVKGAPWTAKSHLPGGNFAVKGYEAEVAKLKSRYPFLADRH
ARRLVCRYGTRAETLLGNARGIDDLGRLFGGDLYEAEVAYLVEHEWARHAEDVLWRRTKD
GLRLSKEQAQSLEEYMAAMPAMAG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgggccgggagatacacgacattttcgtcattggcggcggcatcaacggctgcggcatc
gctcgcgatgctgtcgggcgcggctataccgtggcgctggcggagatgaacgatttcgct
tcgggcacctcatctggcgccaccaagctgatccatggcggcctgcgttatctcgagcat
tacgagttccgcctggtgcgtgaatcgctgatggagcgcgagatcctctgggcgatggcg
ccgcatattatctggccgctgcgtttcgtgctgccttatcataagggcggcatccgccca
gcttggctgatccggctcggcctcttcctctacgaccatcttggcggccgcaagctgctg
ccggcgacgtcggtgcttgacatgcgcaaggatccggccggcaagccgctgaaggcattg
tttacgagagcgttcgaatattccgacggctgggtcgacgatgcccgcatggtggtgctg
aacgcccgcgatgctgccgacaagggtgcgaccatcctgccgcgtaccaaagtggtctcg
gcaaggcgtgagagcggcctatggcacatcgagactgtcgataccgtcaccggccgcaaa
gacggtcatcaggcccgcatgttggtcaatgccgccggtccctgggtcgatcacgtcatt
cgttccgccttcggtcagaaagaagcccacaatgtccgcctcgtccagggcagccatatc
gtcgtcaagaagaagttcgacgatccacgcgcctatttcttccagaatccggacaatcgc
atcatcttcgccattccctatgagggcgacttcaccctgatcggcacgaccgaccgcgac
tataccgccgatcccaaggatgtcaggatctccgaggaggagacggtctatctctgcaat
gcggcgtcggaatatttcaaggagccggtgcggccagaggatatcgtctggacctattcg
gcggtgcgcccgctttatgacgacggcgcctcgaaggcgcaggaggcgacgcgcgactat
gtgctgaagctcgacggcgagagggagaccgcgccgctgcttaatgttttcggcggcaag
ctcaccacttatcgccggctgtccgagcatgcgttggagaagatcggtgctgcgatcggc
gtcaagggtgctccgtggacggccaagagccatctgcccggcggcaatttcgccgtcaag
ggttatgaggccgaggttgccaagctgaaaagccgctatccgttcctcgccgatcggcac
gctcgccggctggtgtgtcgctacggcaccagggccgagacgctactcggcaatgcccgt
ggcattgacgatctcgggcggctgttcggcggcgatctctacgaggccgaggtcgcctat
ctcgtcgaacatgaatgggcccggcacgccgaagacgtgctgtggaggagaacaaaggat
ggtctgcgcctttcgaaggagcaggctcagtcactggaggagtacatggctgccatgccg
gcgatggccggatag

DBGET integrated database retrieval system