KEGG   Rhizobium favelukesii: LPU83_1128Help
Entry
LPU83_1128        CDS       T03046                                 

Gene name
gstB
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rhl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LPU83_1128 (gstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhl02000]
    LPU83_1128 (gstB)
Enzymes [BR:rhl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LPU83_1128 (gstB)
Transporters [BR:rhl02000]
 Other Transporters
  Pores ion channels [TC:1]
   LPU83_1128 (gstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: CDM56802
UniProt: W6R681
LinkDB All DBs
Position
1113071..1113688
Genome map
AA seq 205 aa AA seqDB search
MLTLYFAPHTCALASLIALEESGLPFKTKKLNFAEAEQRSPEYLEINPKGRVPALGTERG
ILTETPAILAYIAQLAPAAQLAPLDPFEFARMQAFNNYICATVHVNHAHGRRGSRWADDP
TAHEAMKAKVPQTMSECFELIDERMLEGPWVMGEYYSVADPYLFVMTGWLRSDGVDPIRF
RKSTAHYAQMMERPAVQRALEREQA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgctgacattgtattttgcgccgcacacttgcgcgcttgcaagcctcattgcgctggag
gagtccggtctgccgttcaaaaccaagaaactgaacttcgccgaagcggagcagcgttcg
ccagagtatctcgaaatcaacccgaagggccgggtccccgcgcttgggacggaacgcggc
atcctaaccgaaacgccggcaatcctggcctacatcgcgcagctcgcgccggccgcgcag
ctggcgccgctcgatcctttcgagttcgcccgcatgcaggccttcaacaattacatctgc
gcgaccgtgcatgtgaaccacgcgcatggccgccggggcagccgatgggcggatgatccg
acggctcacgaggcgatgaaggcgaaggtgccgcagaccatgagcgagtgcttcgagctt
atcgacgagcggatgctggagggcccgtgggtcatgggcgagtactactcggtcgccgac
ccctacctcttcgtcatgaccggatggctgcggtccgatggcgtcgatccgatccgtttc
aggaagtcgacggcgcactatgcccagatgatggagcgcccggccgtccagcgagcattg
gagcgcgagcaggcataa

DBGET integrated database retrieval system