KEGG   Rhizobium favelukesii: LPU83_1189Help
Entry
LPU83_1189        CDS       T03046                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe-Mn family
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rhl  Rhizobium favelukesii
Brite
Enzymes [BR:rhl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LPU83_1189 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CDM56863
UniProt: W6RDU1
LinkDB All DBs
Position
1182917..1183519
Genome map
AA seq 200 aa AA seqDB search
MAFELPELPYDYEALQPVMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKS
FGTNAGLFNNAAQHYNHVHFWKWMKKGGGGNKLPSKLEAAISSDLGGYDKFKADFIAAGT
TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLINWDYVLERYEAAAK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgcccgaacttccctatgactacgaagcgcttcagcccgtcatgtcg
aaggaaaccctggaattccatcacgacaagcaccacaaggcctacgtcgacaacggcaac
aagcttgcggcagaagcaggcctttccgacctctcgctcgaagacgtggtgaagaagtcg
ttcggcaccaatgccgggctctttaacaatgctgcccagcattacaaccacgtccacttc
tggaagtggatgaagaagggcggcggcggcaacaagctgccgagcaagctcgaagctgcc
atcagttccgatctcggtggctacgacaagttcaaggccgatttcattgccgcaggcacg
actcagttcggctccggctgggcatgggtttccgtcaagaacggcaagctcgaaatctcc
aagaccccgaacggcgaaaacccgctcgtacacggcgcaaccccgatcctcggcgtcgac
gtatgggaacactcctattacatcgactaccgcaacgcgcgcccgaagtacctcgaagcc
ttcgtcgacagcctgatcaactgggattacgtcctggagcgctacgaagccgctgcgaag
taa

DBGET integrated database retrieval system