KEGG   Rhizobium favelukesii: LPU83_2053Help
Entry
LPU83_2053        CDS       T03046                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl00564  Glycerophospholipid metabolism
rhl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rhl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LPU83_2053 (glpD)
Enzymes [BR:rhl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LPU83_2053 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox_2 STPPase_N
Motif
Other DBs
NCBI-ProteinID: CDM57710
UniProt: W6RBK7
LinkDB All DBs
Position
1977439..1978956
Genome map
AA seq 505 aa AA seqDB search
MSRQIHDLFIIGGGINGCGIARDAIGRGYTVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREVLWAMAPHIIWPMRFVLPYHKGGIRPAWLIRVGLFLYDHLGGRKLL
PPTAVLDMRRDPAAKPLKALFTKAFEYSDGWVDDARMVVLNARDAADRGALIMPRTKVVS
ARRENGLWSIETIDTVSGQANSFQARMLVNAAGPWVDHVIRAAFGQNEAHHVRLVQGSHI
VVKKKFNDPRAYFFQNPDNRIIFAIPYEQDFTLIGTTDRDYSADPKDVKISEEETAYLCN
AASEYFKEPVRQEDIVWTYSAVRPLFDDGASKAQEATRDYVLKIEGEGESAPLLNVFGGK
LTTYRRLSEHALEKIAAAIGAKGAPWTAKSHLPGGDFAATGYEAEVAKLRGRYPFLADRH
ARRLVRRYGTKASVLLGRATNTEDLGRCFGGDLYEAEVRYLIDHEWARRADDVLWRRTKD
GLRLTKEQAALLEEYMAARPAQMAG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtcagattcacgatcttttcatcatcggcggtggcatcaacggctgcgggatc
gcgcgtgatgcgattgggcgcggctatacggtcgcgcttgcggagatgaacgatttcgcg
tccggcacgtcctccggcgcgaccaagctcatccatgggggcttgcgatatctcgaacat
tacgagtttcgtctggtgcgcgagtcgctgatggagcgcgaagtgctctgggcgatggcg
ccgcacattatctggccgatgcgcttcgtactgccctatcacaagggcggcatccgaccg
gcatggctgatccgcgtcgggctgtttctttacgaccatctcggcggccgcaagctattg
ccgccgaccgccgttctcgacatgcgtcgggatccggctgctaagccgttgaaggcgctc
ttcacgaaggcattcgagtattcggacggttgggtcgacgatgcacgcatggttgtgttg
aacgcgagggatgccgccgaccgcggcgcgctgatcatgccgagaacgaaggtggtgtcg
gcgcggcgcgagaacggtctatggtcgatcgagacgatcgacaccgttagcgggcaggcg
aacagttttcaggcgcggatgctggtgaatgcagccggtccctgggtcgatcacgtcatt
cgcgcggccttcgggcagaacgaggctcaccatgtacggctcgtccagggcagccatatc
gtggtgaagaagaagttcaacgatccgcgtgcctatttcttccagaacccagacaaccgc
atcatcttcgcgatcccctacgagcaggacttcacactgatcggtaccaccgaccgcgac
tactcggccgatccaaaggatgtgaaaatttccgaagaagaaacggcgtatctctgcaac
gcggcgagcgagtatttcaaggagccggtgcggcaggaagacatcgtctggacctattcg
gccgtgcggccgctgtttgatgacggcgcttccaaggcacaggaggcaacccgcgactac
gtgctgaaaatcgaaggcgagggtgaaagtgcgccgctcctcaacgtcttcggcggcaaa
ctcacgacctatcggcggctttccgagcatgcgctggaaaaaatcgctgcggcgatcggt
gccaaaggcgcgccgtggacagcgaaaagccatctgccgggcggcgatttcgcagcaacc
ggctatgaggctgaagtcgcgaaactgaggggccgctatccgttcctggccgaccggcac
gcgcgccgactggtgcgccgctacggcacgaaggcgtcggttcttcttggacgggcgacc
aacaccgaggacctcggacgctgtttcggtggcgatctctacgaagcagaggttcgctat
ctcatcgatcacgaatgggccagacgcgcagatgatgtgctgtggcgaagaacgaaggac
ggcctgcgtctaaccaaggaacaggctgcgctattggaggagtacatggccgcgcgaccg
gcacagatggctggttga

DBGET integrated database retrieval system