KEGG   Rhizobium favelukesii: LPU83_2281Help
Entry
LPU83_2281        CDS       T03046                                 

Gene name
gstA3
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rhl00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LPU83_2281 (gstA3)
Enzymes [BR:rhl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LPU83_2281 (gstA3)
Transporters [BR:rhl02000]
 Other Transporters
  Pores ion channels [TC:1]
   LPU83_2281 (gstA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: CDM57938
UniProt: W6RGV0
LinkDB All DBs
Position
complement(2223180..2223800)
Genome map
AA seq 206 aa AA seqDB search
MADELIFYTNPMSRGRIARWMLEETGVPYKTEIMTFGGTMKSPEYLAVNPMGKVPAVRHG
KTVVTECAAICAYLADAFPEADLAPTPDERGSYYRWMFFTAGPLEAAATNKALGFETPPD
KARMAGYGRFADVMNTLEHAVSTTPYVAGDRFTAADVYVGSHIGWGLGFGTIEKRQAFVD
YLGRVTDRPAHKRAVAIDDEAMKIAQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaactaatattctataccaaccccatgtcgcgtggtcgcatcgcccgctgg
atgctggaggagacaggcgtaccgtacaaaacagagatcatgacctttggcggaaccatg
aagtcgccggagtaccttgccgtcaacccgatgggcaaggttcccgcggtccggcatggc
aagacggtcgtcaccgagtgcgccgcaatctgcgcttacctcgctgacgccttccccgag
gcagaccttgcgccaacgccggatgaacgcggcagctactatcgctggatgttctttacc
gccggaccgctcgaagccgcagccaccaacaaggcattgggctttgaaacgcctcccgac
aaagcccggatggcgggatatggcagattcgccgatgtgatgaacacgctggagcacgcc
gtcagtaccacgccctacgttgccggagatcgcttcacggcggccgacgtctacgtcggc
tcgcatattggctggggcctgggcttcggcaccatcgagaagcggcaggcctttgtcgat
tatctcggccgagtcaccgatcgcccggcccataagcgcgccgtcgcaatcgatgacgag
gccatgaagatcgcccagtag

DBGET integrated database retrieval system