KEGG   Rhizobium favelukesii: LPU83_2396Help
Entry
LPU83_2396        CDS       T03046                                 

Gene name
hisI
Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl00340  Histidine metabolism
rhl01100  Metabolic pathways
rhl01110  Biosynthesis of secondary metabolites
rhl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rhl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    LPU83_2396 (hisI)
Enzymes [BR:rhl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     LPU83_2396 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: CDM58052
UniProt: W6R9Z2
LinkDB All DBs
Position
complement(2333890..2334348)
Genome map
AA seq 152 aa AA seqDB search
MMPFAFNAPSDDKSELEDAGDFTPRFDDRGLITAIVTDATDGELLMVAHMNAQALALTIQ
TGKAHYFSRSRGKLWIKGETSGNTQMVKEIRTDCDQDAIWLKVEVAGHDATCHTGRRSCF
YRTVNLEDGKPMLDIVDDELQFDPNEVYGKET
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgatgccctttgcattcaatgcaccgtccgacgacaaatccgaactcgaggacgcgggc
gacttcacgccgcggttcgacgatcgcggcctgatcactgcgatcgtcaccgatgccact
gatggcgagttgctgatggtggcgcatatgaatgcacaggccctcgccctgaccatacag
acggggaaggctcactacttcagccgctcccgcggcaagctctggatcaagggcgaaacg
tcgggcaacacccagatggtcaaggaaatccggacggattgcgatcaggacgccatctgg
ctgaaggtcgaggtagctggccacgatgccacctgtcacaccggccgccggtcctgcttc
tatagaaccgtcaacctcgaagacggcaagccgatgctcgatatcgtcgatgacgagctc
cagttcgacccgaatgaagtttacggaaaagaaacgtaa

DBGET integrated database retrieval system