KEGG   Rhizobium favelukesii: LPU83_2728Help
Entry
LPU83_2728        CDS       T03046                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl00473  D-Alanine metabolism
rhl00550  Peptidoglycan biosynthesis
rhl01100  Metabolic pathways
rhl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rhl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LPU83_2728 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LPU83_2728 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LPU83_2728 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rhl01011]
    LPU83_2728 (ddl)
Enzymes [BR:rhl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LPU83_2728 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:rhl01011]
 Precursor biosynthesis
  Amino acid ligase
   LPU83_2728 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: CDM58380
UniProt: W6RDJ1
LinkDB All DBs
Position
complement(2666780..2667706)
Genome map
AA seq 308 aa AA seqDB search
MSRKHVAVLMGGFSSERPVSLSSGTACADALEAEGFQVTRIDVDRDVSAKLAALRPDVVF
NALHGPYGEDGTIQGVLEYLEVPYTHSGVLASALAMDKEKAKGVAAAAGVPVAQSEVINR
FAFPAEHPMKPPYVVKPVREGSSFGVVIVQEDQSHPPQIISSPDWRYGEEVLVERYVYGR
ELTCGVMGDQVLGVTEVVPLGHGFYDYDAKYVAGGSKHVIPAEISPNIYQKIQSLALRAH
QAIGCRGVSRSDFRYDDRFSEDGEIIWLEINTQPGMTPTSLVPEMAGHAGYSFGEFLRWM
VEDASCSR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcaagcatgtcgctgtcctgatgggcgggttttcctcggagaggccggtaagc
ctctcttccgggacggcgtgcgcggatgcccttgaggctgagggtttccaggtgacgcgg
attgacgtcgatcgcgatgtgtctgcgaagcttgctgcactgcgacccgatgtcgtcttt
aatgcgctgcatggcccctacggcgaggatggtacgatccagggcgtcctcgagtatctt
gaggttccctacacgcattccggcgtgctggcttcggcgcttgccatggacaaggagaag
gcaaagggcgttgccgccgccgcgggcgttccggttgctcaatcagaggtgatcaatcga
ttcgcctttccagccgagcatccgatgaagccgccctatgttgtgaagcctgtgcgtgag
ggctccagcttcggtgtggtgatcgtccaggaggatcaatcgcatccgccgcagattatc
agctctccggactggcgctacggcgaagaggttcttgtcgagcgttacgtctatggccgg
gagctgacttgcggtgtcatgggggatcaggtgcttggcgtgaccgaggtggtgccgctg
ggccatggcttctacgattatgacgccaagtatgtcgcaggtggatcgaaacacgtcatc
ccggcggaaatttcaccgaatatttaccaaaaaatacaatcattggcattaagggcgcat
caagcaattggttgccgtggcgtcagtcgctccgactttcgttacgacgatcgcttctcc
gaagatggcgaaattatctggctggaaatcaatactcagccgggcatgacgccaacctcc
ctggtgcccgaaatggctggtcatgccggctactcatttggtgaatttctccgttggatg
gtggaggacgcttcttgttctcggtga

DBGET integrated database retrieval system