KEGG   Rhizobium favelukesii: LPU83_2988Help
Entry
LPU83_2988        CDS       T03046                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl00240  Pyrimidine metabolism
rhl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LPU83_2988 (tdk)
Enzymes [BR:rhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LPU83_2988 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 DUF2075
Motif
Other DBs
NCBI-ProteinID: CDM58639
UniProt: W6RCQ1
LinkDB All DBs
Position
complement(2938934..2939632)
Genome map
AA seq 232 aa AA seqDB search
MTVSGLDFPVIIKMRDFSSQFRASKKRKTEKTMAKLYFNYSTMNAGKSTMLLQASYNYEE
RGMRVVLLIAAFDERVGKGIIGSRIGLKASAVGFEPEADLQALIGDLSKEGEPIACVFVD
EAHFMTREHVWQLARIVDRMNIPVMVYGLRTDFQGKLFPASEELLAIADEMREVRTICHC
GRKATMVVRLDAEGKVLREGAQIDVGGNEKYVSLCRRHWDDAMNGEWLAEAV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
ttgacggtttctggcctcgattttcctgtgattatcaaaatgagggacttttcttcgcag
tttcgagcttccaaaaagcgaaagacggagaaaacgatggcaaaactctattttaactac
tcgaccatgaatgccggcaagtcgacgatgctgctgcaggcctcctataattacgaggag
cgcggcatgcgtgtcgttttgctgattgcggccttcgacgagcgcgtcggaaaggggatt
atcggctcccggatcgggctcaaggcgagcgccgtcggcttcgaaccggaagcggacttg
caggccttgatcggcgacctcagcaaggagggggagccaatcgcttgcgtcttcgtcgac
gaagctcatttcatgacgcgcgaacatgtctggcagctcgcccggatcgtcgaccgcatg
aacattccggtcatggtctatgggctcaggaccgattttcaagggaaactgtttcccgcg
tctgaggagcttcttgcgatcgccgacgagatgcgcgaggtccggacgatctgccattgc
gggcgcaaggcgacgatggtggtacgcctcgacgcagaaggaaaggtgctgcgcgaaggc
gcgcagatcgatgtcggcggcaacgaaaagtacgtgtctctgtgccggcgccattgggat
gacgccatgaacggggaatggctcgccgaagcggtatga

DBGET integrated database retrieval system