KEGG   Rhizobium favelukesii: LPU83_pLPU83c0258Help
Entry
LPU83_pLPU83c0258 CDS       T03046                                 

Definition
(GenBank) putative ABC transporter permease protein yesQ
  KO
K02026  multiple sugar transport system permease protein
Organism
rhl  Rhizobium favelukesii
Module
rhl_M00207  Putative multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:rhl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhl02000]
    LPU83_pLPU83c0258
Transporters [BR:rhl02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    LPU83_pLPU83c0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
LinkDB All DBs
Position
pLPU83c:245883..246761
Genome map
AA seq 292 aa AA seqDB search
MTTSEGALHPDSVSRNKTLRRIGTFVSYAALSLIALLFLFPFFWMVSNAVRSNAEVLAVP
VRILPQEYQWGNFVEALVSLPFGTFLFNSFVVASGVTAIVIAVSCLSAYSFARLKFPGRE
GLLLAYLGTLMIPQVMLVIPLFLVVSKLGWVNTYHGMILPMAFGSFGAFLLRQFFLGIPK
DLDEAAMIDGASRLRILVTIIVPLAMPAIGLLALFTFMGQWKSFLWPLIITNGMDKATLP
LGLTLFQTQQGTSWNYIMAGAAISMLPGIFLAVVLQKVIYRGIAISSGFGGR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacgactagcgagggcgccttgcacccggattctgtgtcgcggaacaaaaccctgcgg
cgcattggcacgttcgtcagttacgccgcgctttcgctgatcgcgttactgttcctcttc
cccttcttctggatggtgtcgaacgcggtacgctccaacgcggaagtcctggccgtaccg
gtccgcatcctgccacaggagtatcaatggggaaacttcgtcgaagcattggtttccctg
ccgtttggaaccttcttgttcaactccttcgtggtcgctagcggcgtcacggcgatcgtg
attgcggtgtcgtgcctttccgcctactctttcgcccggctgaagtttcccggccgggag
ggtctgctgctcgcttatctcggcacgctgatgattccgcaggtgatgttggtcatcccg
cttttcctggtggtcagtaagctcggctgggtcaacacctatcatggcatgatcctgccg
atggcgttcggctccttcggcgcatttttgctgcggcagttctttctcggcattcccaag
gatctcgacgaggcggcgatgatcgacggggcttcgcgcctgcgcatcctggtcacgatc
atcgttccgcttgcaatgccggccatcggcctgctggcgctgttcaccttcatggggcag
tggaaaagcttcctgtggccgctgattatcaccaacggcatggacaaagctacgctgccg
ctcgggctcaccttgttccagacacagcagggcacgtcgtggaactacatcatggccggc
gcggccatctccatgctgccgggcatcttcctggccgtcgtgctgcagaaggtgatctac
cggggcatcgccattagctccggattcggcgggcgttaa

DBGET integrated database retrieval system