KEGG   Rhizobium favelukesii: LPU83_pLPU83d1610Help
Entry
LPU83_pLPU83d1610 CDS       T03046                                 

Definition
(GenBank) phage SPO1 DNA polymerase-like protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
rhl  Rhizobium favelukesii
Pathway
rhl03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:rhl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LPU83_pLPU83d1610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rhl03400]
    LPU83_pLPU83d1610
Enzymes [BR:rhl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     LPU83_pLPU83d1610
DNA repair and recombination proteins [BR:rhl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     LPU83_pLPU83d1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
LinkDB All DBs
Position
pLPU83d:1612981..1613619
Genome map
AA seq 212 aa AA seqDB search
MAELLGPTLAQPGALGTNLGEIHREATTCRRCNLYKHATQLVFGEGPTSAKVVFVGEQPG
DKEDLAGQPFVGPAGKLLDRCLEEAGIERDACYVTNAVKHFKFEPRGKRRIHAKPTRGEV
QICAWWLAAELRLIRPKLVVALGATAVYSLLGPQAKVTRDRGSVLRSPAGLYVFVTIHPS
ALLRMLDQPAGRQSRARFVDDLKAVATLLEHA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcagaactgctcggcccgacattggcgcaaccaggtgcattgggtacgaatctgggc
gagattcatcgggaagcaacgacctgcaggcgatgcaacctctacaaacacgcaacgcag
ttggtgtttggggaaggtccgaccagtgccaaagttgtcttcgttggcgagcagccggga
gacaaggaggatcttgccgggcaaccgttcgttggccccgcgggaaagctgctggatcgc
tgtctcgaggaagcgggtatcgaacgcgatgcctgttacgtcaccaatgccgtaaagcac
ttcaagttcgaacctcgcggcaaacgacgcatccacgccaaaccgaccaggggagaggtt
cagatctgcgcgtggtggctggcagcagaattgcgcctcatacggccgaaactcgtcgtg
gcgctcggtgcgacggcggtctattccttgctcgggccacaagcaaaggtcactcgcgac
cgaggctccgtccttcgttcgccggccggattgtatgtgtttgtcacgatacatccctcg
gcgctgctgcgaatgctcgaccagccggccggtcggcaaagcagagcgcgcttcgtcgat
gacctgaaagctgtcgccacgcttcttgagcatgcatag

DBGET integrated database retrieval system