KEGG   Rhodovulum sp. MB263: B5V46_02235
Entry
B5V46_02235       CDS       T04771                                 

Definition
(GenBank) glycine/betaine ABC transporter permease
  KO
K02001  glycine betaine/proline transport system permease protein
Organism
rhm  Rhodovulum sp. MB263
Pathway
rhm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rhm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    B5V46_02235
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhm02000]
    B5V46_02235
Transporters [BR:rhm02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter
    B5V46_02235
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: ARC87526
UniProt: A0A1V0HUA1
LinkDB
Position
complement(442431..443465)
AA seq 344 aa
MASYDFIFDGLGLRDWCDGGASSAPMSMADLLGQARGSAQPATSLWDLPFPSMDALNDAC
PAFPQARELTKGLETGFLSIKDGLSVVLDPLTQPLSWALEGALWLFQTSPWWIMIPLILL
VVRLVARSWGLVAFVAACIGFLAFINHYDYAMQTLAIIFVCAFICVLVGVPIGIAMSRSD
NFQRIAIPILDMLQTLPPFVYLIPLIFLFSVTEPKLYGIAVIVYAIVPVVRLTNLGIRLV
DKEVIEAADAFGMTKRQKLWGVQIPLALPNIMAGVNQTIMMSLAMVVIASMVSAPGLGVL
VLRGIRNLELGVGLVSGLGIVLLAVMLDRVTKAALARVNAAQKQ
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggcaagctatgatttcatattcgacgggctcggcctgcgcgactggtgcgacggcggc
gcatcctcggcgccgatgtcgatggcagacctgctgggccaggcccgcggatcggcccag
ccagccacctcgctctgggacctgccctttccctcgatggacgcgctgaacgacgcctgt
ccggcctttccgcaggcccgcgagctgaccaaggggctcgagaccggcttcctgtcgatc
aaggacgggctcagcgtcgtgctcgacccgctgacccagccgctgagctgggcgctcgaa
ggcgcgctgtggctgttccagacctcgccctggtggatcatgatcccgctgatcctcttg
gtcgtgcgcctggtcgcgcggtcctgggggctggtggccttcgtggccgcctgcatcggc
ttcctggccttcatcaaccattacgactacgcgatgcagacgctggcgatcatcttcgtc
tgtgccttcatctgcgtgctggtgggggtgcccatcggcatcgccatgtcccgaagcgac
aatttccagcggatcgcgatcccgatcctcgacatgctgcagacgctgccgcccttcgtc
tacctgatcccgctgatcttcctgttctcggtgaccgagcccaagctttatggcatcgcg
gtgatcgtctacgccatcgtgccggtggtccggctgaccaatctcggcatccggctggtg
gacaaggaagtgatcgaggccgccgacgccttcggcatgaccaaacgccagaagctctgg
ggggtgcagatcccgctggcgctgcccaatatcatggccggcgtcaaccagaccatcatg
atgagcctcgccatggtcgtgatcgcctcgatggtctcggcaccgggtctgggcgtgctg
gtgctgcgcggcatccgcaatctcgaactgggcgtgggtctggtctcggggctcgggatc
gtgctgctcgcggtgatgctcgaccgcgtcaccaaggccgcgctcgcccgcgtcaacgcg
gcacagaaacagtga

DBGET integrated database retrieval system