KEGG   Rhodovulum sp. MB263: B5V46_02975Help
Entry
B5V46_02975       CDS       T04771                                 

Definition
(GenBank) hypothetical protein
Organism
rhm  Rhodovulum sp. MB263
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PilP
Motif
Other DBs
NCBI-ProteinID: ARC87656
UniProt: A0A1V0HUN0
LinkDB All DBs
Position
complement(604882..605463)
Genome map
AA seq 193 aa AA seqDB search
MVAADPALAARIASYSPRTRPASVLARAENPATAVPGTHPRARPEDLAPAPATDAAVTAA
LEDLADGEDEAADSDELPDNALSASLRPASRPSDFEDRTVQAVAAPVQPAIPTAASVARQ
ATLPDAINLRNLNLIGVYGTSADRRALLRLPSGRFVKVKVGDTVDGGQVAAIGETQLRYV
KRGRNIVLDLPGG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgcggccgaccccgccctggccgcccggatcgcaagctactcgccccgcacccgg
cccgcatccgttctggcccgggccgaaaacccggccaccgctgttcccggcacgcatccg
cgggcacggccagaagacctggcgcccgcgcccgccaccgatgccgctgtgacggccgca
ctggaagacctcgccgacggcgaggacgaggctgcggactccgacgaactgcccgacaac
gcgctcagcgcctcgctccgcccggcctcgcgcccttcggatttcgaggacaggacggtg
caggccgttgcagccccggtgcaaccggccattcccaccgccgcatcggtcgcccggcag
gccaccctgcccgatgccatcaatcttcgtaatctcaacctgatcggcgtctacggaacc
tcggccgaccgccgcgcgctgctgcggctgccctctggccgcttcgtgaaggtcaaggtc
ggcgacaccgtcgatggcggccaggtcgcggccatcggcgaaacccagctgcgctatgtc
aagcgcggccgcaatatcgtactggacctgccgggcggctga

DBGET integrated database retrieval system