KEGG   Rhodovulum sp. MB263: B5V46_08915Help
Entry
B5V46_08915       CDS       T04771                                 

Definition
(GenBank) twin-arginine translocation pathway signal
  KO
K09947  uncharacterized protein
Organism
rhm  Rhodovulum sp. MB263
Brite
KEGG Orthology (KO) [BR:rhm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    B5V46_08915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1513
Motif
Other DBs
NCBI-ProteinID: ARC88729
UniProt: A0A1V0HXT8
LinkDB All DBs
Position
complement(1908579..1909667)
Genome map
AA seq 362 aa AA seqDB search
MADRRSFLTGALAASLCPRVGWADAGSPAFLSAAQESDGRQMLVGLDAGGGERFRLPLPQ
RGHAAAAHPIRPEATAFARRPGTFALVIDCREGRINAVLDAPEGRHFYGHGAYSADGRYM
YTAENDYDAARGVIGVWDTEAGYLRVGEFDSHGTGPHEIRLMPDGRSLVIANGGIETHPD
SGRTKLNIPFMAPNLAYVSLEGTLLETVAPPEEWHMNSIRHLALGPGGTVAFAMQWQGPR
EERPPLLGLHRPGTAPVWLDAPGEEHAAMQGYAGSVAISGDGAEVAISSPRGGRVQVFDI
AAERFTGAIEAHDVCGLAPAEGGGFVATTGTGTVLGLQGLRPVWTVRQARSFDNHLVTVG
VA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcgccgaagcttcctgaccggggcgcttgccgcctcgctctgcccccgggtg
ggctgggccgatgccggcagcccggcctttctgagcgccgcgcaggaaagcgacgggcgg
cagatgctggtcgggctagatgccgggggcggcgagaggttccgcctgcccctgccccag
cgcggccatgccgccgccgcccatccgatccggcccgaggccacggcgtttgcccgccgc
cccggcaccttcgcgctggtgatcgactgtcgcgaggggcggatcaacgccgtgctcgac
gcacccgaggggcggcatttctacggccatggcgcctattccgccgacgggcgctacatg
tacacggccgaaaacgactatgatgcggcgcgcggcgtgatcggggtctgggacaccgag
gcaggctatcttcgggtcggcgaattcgacagccatggcaccggtccgcatgagatcagg
ctgatgcccgacggccgcagcctggtgatcgccaatggcgggatcgagacccatcctgac
agcggccggaccaagctcaacatcccgttcatggcgccgaacctcgcctatgtgagcctc
gaggggacgctgcttgaaaccgtcgcgccgcccgaggagtggcacatgaattcgatccgg
catctggcgctgggcccgggcggcaccgtcgccttcgccatgcaatggcagggcccgagg
gaagagcggccgccgcttctgggcctgcaccggccgggaaccgcgccggtctggcttgac
gctcccggcgaggaacatgccgcgatgcagggctatgcgggctcggtcgcgatctccggg
gatggggccgaggtcgcgatctcgtcgccgcgcggcggccgggtacaggtcttcgacatc
gcggcagagcggtttacgggcgcgatcgaggcccacgatgtctgcggcctggcccccgcc
gagggcggcggcttcgttgccacgaccgggaccgggacggtgctggggctgcagggcctg
cgcccggtctggacggtccggcaggcccgttccttcgacaaccacctggtgacggtgggc
gtggcctga

DBGET integrated database retrieval system