KEGG   Rhodovulum sp. MB263: B5V46_10865Help
Entry
B5V46_10865       CDS       T04771                                 

Definition
(GenBank) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
rhm  Rhodovulum sp. MB263
Pathway
rhm00500  Starch and sucrose metabolism
rhm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B5V46_10865
Enzymes [BR:rhm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     B5V46_10865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ARC89074
UniProt: A0A1V0HYP6
LinkDB All DBs
Position
complement(2332751..2334031)
Genome map
AA seq 426 aa AA seqDB search
MSAGPDRGWVAARREGAARALRRAVSATGLSRHRAGFGWTVVPAPGSVLASTRVASWDPE
PDYFHHWTRDAAIALAAIPEAMAAEPGAAGFWRQAVSDHVRFSLAISDPDRRGSCVNPLK
DSATEAFRPYLRPDAELSALTGAAWLAEPRCAADGGPDLERWGRPQFDGPALRAAALMRL
GAAMPEARGAEPDRLIARDLDFTLAMAGAPCLGPWEEEPARRSSFTLIAQWDALDLGARR
LGRADLAEAAGKIADLIAGAADPVSGGWRESLEAAPGALDAATVLALVQAGRRDGPFALT
APRTRATMAALEALFAGLYPVNQGRTAPALGRRAGDVFFGGNPWFPVTLGFAEAYYRIAA
ATGAAAEFERAEALMAVVEDLAPEGDDLPEQADRETGAPASCLGLTWSSAAFLMAAAARD
QALAAR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcggggccggaccggggttgggtcgcggcccggcgcgagggcgcggcgcgggcg
ctgcgccgcgcggtgtcggccaccgggctgtcccgccaccgcgcgggcttcggctggacg
gtggtgcctgcgccggggtcggtcctggcctcgacgcgggtggcctcatgggaccccgag
cccgattatttccaccactggacccgcgatgcggccattgcgcttgccgccattcccgag
gcgatggcggccgagcccggggcggcggggttctggcggcaggcggtcagcgatcatgtc
cgcttttcgctggcgatttcggaccccgaccggcgcgggtcttgcgtcaaccctctgaaa
gacagcgcgaccgaggccttccggccctatctgcgccccgatgccgaactttccgccctg
accggcgccgcctggctggccgagccgcgttgtgccgccgatggcggccccgatctcgaa
cgctgggggcggccgcaattcgacgggcctgcgctgcgggccgcggcgctgatgcggctg
ggcgcggcgatgcccgaggcgcgaggcgcggagcccgaccggctgatcgcacgcgatctc
gacttcacgctggccatggccggggcgccctgcctcggcccctgggaggaagagcccgcc
cggcgcagcagcttcacgctgatcgcgcagtgggatgcgctcgatctcggggcgcggcgt
ctcgggcgggcggatctggccgaggcggccgggaagatcgccgatctgatcgcaggcgcc
gccgatccggtctcgggcggctggcgcgaaagcctcgaggcggcgccgggcgcgctcgat
gccgcgacggtgctggcgctggtgcaggccgggcgcagggatggccccttcgcgctgacc
gcgccccggacccgggccaccatggcggcgctcgaggcgctgtttgccgggctctatccc
gtgaaccagggccgcaccgcgcccgcgctggggcgccgggcgggggatgtcttcttcggc
ggcaatccgtggtttccggtcacgctgggctttgccgaggcctattaccggatcgcagcg
gcaaccggcgctgcggccgagttcgagcgggccgaggcgctgatggcggtggtggaagac
ctcgcgcccgagggcgacgacctgcccgaacaggccgaccgcgagaccggcgcgcctgcc
tcctgccttgggctgacctggtcatctgccgccttcctcatggccgcggccgcccgcgat
caggcgctggccgccagatag

DBGET integrated database retrieval system