KEGG   Rhodovulum sp. MB263: B5V46_13475Help
Entry
B5V46_13475       CDS       T04771                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rhm  Rhodovulum sp. MB263
Pathway
rhm00061  Fatty acid biosynthesis
rhm00780  Biotin metabolism
rhm01100  Metabolic pathways
rhm01130  Biosynthesis of antibiotics
rhm01212  Fatty acid metabolism
Module
rhm_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rhm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B5V46_13475
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    B5V46_13475
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    B5V46_13475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rhm01004]
    B5V46_13475
Enzymes [BR:rhm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     B5V46_13475
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     B5V46_13475
Lipid biosynthesis proteins [BR:rhm01004]
 Fatty acid synthase
  Component type
   B5V46_13475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ARC89543
UniProt: A0A1V0I052
LinkDB All DBs
Position
2883955..2884743
Genome map
AA seq 262 aa AA seqDB search
MPELMKGKRGLVMGVANDRSIAWGIAKAMAAEGAELAFSYQGENFGRRVQPLAESVGSSL
MVDVDVTDDDSLDAAFGRIEQEWGGLDFLVHAIAYSDKTELTGRFINTSRENFRNSLTIS
CYSLIEVARRAQPLMPGGGTILTLTYQGSNRVTPFYNVMGVAKAALESTVRYLASDLGPE
GIRVNAISPGPMKTLAGAAIAGGRKTFRHTEINAPLGHNATLEAIGGTAVYLASDMGACT
TGEIITVDGGYHVLGMPRFENI
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttgatgaaaggaaagcggggcctcgtcatgggcgtcgccaatgaccggtcg
atagcctggggcatcgcgaaggcgatggccgccgagggagcagagcttgcattctcgtat
cagggcgagaatttcggccgccgcgtccagccgctggccgaaagcgtggggtcgagcctc
atggtcgatgtcgacgtgaccgacgacgactctctcgacgcggccttcggccggatcgag
caggaatggggcgggctcgacttcctcgtccatgccatcgcctattccgacaagaccgag
ctgaccgggcgtttcatcaacacctcgcgcgagaacttccgcaactcgctgacgatctcg
tgttattcgctgatcgaggtggcgcgccgggcgcagccgctgatgcccggtggcggcacc
atcctgaccctgacctatcagggctcgaaccgggtgacgcccttctacaacgtcatgggc
gtggccaaggcggcgctggaatcgacagtgcgctatctggcctccgatctcggccccgag
ggcatccgggtcaacgcgatctcgcccgggccgatgaagacgctggcaggcgcggccatc
gcgggcgggcgcaagaccttccgccataccgagataaacgccccgcttggccacaacgcc
acgctcgaggcgatcggcggcaccgcggtctatctggcctcggacatgggggcctgcacc
accggcgagatcatcaccgtcgatggcggctatcacgtcctcggcatgccgcgcttcgag
aatatctga

DBGET integrated database retrieval system