KEGG   Rhizobium sp. N1341: AMJ98_CH00095Help
Entry
AMJ98_CH00095     CDS       T04420                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rhn  Rhizobium sp. N1341
Pathway
rhn00250  Alanine, aspartate and glutamate metabolism
rhn00410  beta-Alanine metabolism
rhn00640  Propanoate metabolism
rhn00650  Butanoate metabolism
rhn01100  Metabolic pathways
rhn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AMJ98_CH00095 (gabT)
   00650 Butanoate metabolism
    AMJ98_CH00095 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMJ98_CH00095 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMJ98_CH00095 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhn01007]
    AMJ98_CH00095 (gabT)
Enzymes [BR:rhn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AMJ98_CH00095 (gabT)
Amino acid related enzymes [BR:rhn01007]
 Aminotransferase (transaminase)
  Class III
   AMJ98_CH00095 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANL07832
LinkDB All DBs
Position
complement(104343..105623)
Genome map
AA seq 426 aa AA seqDB search
MTATSLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGRRYIDFAAGIAVLNTGHRHPR
VIAAVKDQLDRFTHTCHQVVPYESYVHLAERLNALVPGDFEKKTIFVTTGAEAVENAVKI
ARAATGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVFHVPFPVELHGVSVD
QSLAALKKLFAADVDPQRVAAIILEPVQGEGGFYPAPAAFMKALRELCDQHGILLIADEV
QTGFARTGRMFAMDHHEVAADLTTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGN
PLGIAAAHAVLDVIKEEDLCNRANLLGGRLKQRLESLRESVPEITDIRGPGFMNAVEFND
RTTGLPSADFANKVRLTALDKGLILLTCGVHGNVIRFLAPITIQDEVFGEALDILETSML
EASAAS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgacaagccttaccgaccggaagaacgccgcgatttcacgcggtgtcggcatg
accacccagatttatgcggaccgcgcagagaatgccgaaatctgggacaaggagggccgc
cgctatatcgatttcgccgccggcatcgccgtgctcaacaccggtcaccgccatcccagg
gtcattgctgcggtcaaggatcaactcgaccgcttcacccacacctgccatcaggtggtg
ccctacgagagctacgtgcatctcgccgaacggctgaatgcgctggtgcccggcgacttc
gagaagaagaccatcttcgtcacgacaggtgccgaagcggtcgaaaacgccgtcaagatc
gcgcgcgccgccaccggccgctcggccgtcatcgccttcggcggcggcttccacggccgc
acattcatgggcatggcgctgaccggcaaggtcgtgccctacaaggtcggcttcggcgcg
atgccgggcgacgtcttccatgttcccttccctgtcgaactgcatggcgtctccgtcgat
cagtcgcttgcggcgctgaagaaactcttcgccgccgatgtcgatccgcagcgcgtcgcg
gccatcattctcgagccggtacagggcgaaggcggcttctatccggcgcccgcagccttc
atgaaggccctgcgcgaactttgcgaccagcatggcatcctgctgatcgccgatgaggtg
cagaccggttttgcccgcaccggcaggatgttcgcgatggaccaccacgaagtggcggcc
gatctgacgacgatggcgaagagccttgccggtggctttccgctcgctgccgtcaccggc
cgcgccgaaatcatggacgcgccggggccgggcgggctcggcggcacctatggcggcaat
ccgctcggtatcgccgctgcccatgccgtcctcgacgtcatcaaggaggaggatctctgc
aaccgcgccaacctgctcggcgggcggctcaagcagcggctggaatcgctgcgcgagagc
gtaccggagatcaccgatatccgcgggccgggcttcatgaacgccgtcgaattcaatgac
cggacgacgggattgccgagtgctgatttcgccaacaaggtgcggctgacagcgctcgac
aaggggctgatcctgctcacctgcggcgtccatggaaacgtcatccgcttcctcgcgccg
atcaccatccaggacgaggtcttcggcgaggcgctcgacattctcgaaacctcgatgctg
gaggcgagtgccgccagctag

DBGET integrated database retrieval system