KEGG   Rhizobium sp. N1341: AMJ98_CH00243Help
Entry
AMJ98_CH00243     CDS       T04420                                 

Gene name
fabZ-1
Definition
(GenBank) (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase 1
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
rhn  Rhizobium sp. N1341
Pathway
rhn00061  Fatty acid biosynthesis
rhn00780  Biotin metabolism
rhn01100  Metabolic pathways
rhn01212  Fatty acid metabolism
Module
rhn_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rhn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AMJ98_CH00243 (fabZ-1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AMJ98_CH00243 (fabZ-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rhn01004]
    AMJ98_CH00243 (fabZ-1)
Enzymes [BR:rhn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AMJ98_CH00243 (fabZ-1)
Lipid biosynthesis proteins [BR:rhn01004]
 Fatty acid synthase
  Component type
   AMJ98_CH00243 (fabZ-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ANL07974
LinkDB All DBs
Position
complement(255829..256308)
Genome map
AA seq 159 aa AA seqDB search
MSDATNAVAFDINGIISHQRNRYPVLLIDRVTAVDPGRSASAVKCFTYNEWFFPGHFDDE
PNVPGFIQIESLTQTFIMTFLCMEEYKGMKTNFVSLNNVKFKRKIVPGDVLEIDAVLASF
KRGIAIGSVSSAVRGEPACSGDFIVAVPDILDRFKPKTP
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgcaacgaacgccgtcgctttcgatatcaacggcattatcagccatcagaga
aatcgctatcctgttctgctgatcgatcgcgtcacagcggtcgatcccggcaggagcgcc
tcggcggtgaagtgctttacctataatgaatggttcttccccggccatttcgatgatgag
ccgaatgtgccgggtttcatccagatcgaatcgctgacgcagaccttcatcatgaccttc
ctctgtatggaggaatacaagggcatgaagaccaatttcgtttcgctcaacaatgtgaag
ttcaagcgcaagatcgttccgggcgacgtcttggagatcgatgcagtcctcgcctccttc
aagcgcggaattgcaatcggctcggtcagcagcgcggtgagaggcgaacctgcctgcagc
ggcgatttcatcgtggccgtgcccgacatcctggatcgcttcaagccgaaaaccccatga

DBGET integrated database retrieval system