KEGG   Rhizobium sp. N1341: AMJ98_CH01243Help
Entry
AMJ98_CH01243     CDS       T04420                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rhn  Rhizobium sp. N1341
Brite
Enzymes [BR:rhn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AMJ98_CH01243 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ANL08957
LinkDB All DBs
Position
1255471..1256073
Genome map
AA seq 200 aa AA seqDB search
MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKS
FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGA
TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA
FIDSLINWDYVLERYEEATK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgcctgaacttccctatgattacgaagcccttgcccccttcatgtcg
aaggaaacgctggagtttcaccacgacaagcaccacaaggcctatgtggacaacggcaac
aagctcgccgccgaagccggcctttcggatctgtcgctcgaagacgtcgtgaagaagtcc
ttcggaaccaatgccggcctcttcaacaacgccgcgcagcactacaaccacatccatttc
tggaagtggatgaaaaagggcggcggcggcaacaagctgcctggcaagctggaagcggct
ttcgcctccgatctcggcggctacgacaagttcaaggccgatttcgccaatgccggcgcc
acccagttcggctccggctgggcctgggtttccgtcaagaacggcaagctcgaaatctcc
aagaccccgaacggcgagaacccgctcgtccacggcgccactccgatcctcggcgtcgac
gtctgggaacactcctattacatcgactatcgcaacgcccgcccgaaatacctcgaagcc
ttcatcgacagcctgatcaactgggactacgtcctggagcgctacgaagaagccacgaag
taa

DBGET integrated database retrieval system