KEGG   Rhizobium sp. N1341: AMJ98_CH02314Help
Entry
AMJ98_CH02314     CDS       T04420                                 

Gene name
treS
Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rhn  Rhizobium sp. N1341
Pathway
rhn00500  Starch and sucrose metabolism
rhn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMJ98_CH02314 (treS)
Enzymes [BR:rhn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AMJ98_CH02314 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AMJ98_CH02314 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ANL09976
LinkDB All DBs
Position
2319287..2320948
Genome map
AA seq 553 aa AA seqDB search
MINDLWYKNAVIYCLSVETFMDANGDGVGDFQGLMRRLDYLSGLGVTAIWLMPFQTSPGR
DDGYDVSDYYNVDPRYGSLGDFVEFTHGAKQRGIRVLIDLVINHTSKDHPWFEDARSDPH
SRYREWYVWSDKKPANADQGMVFPGVQKTTWTYDEKAKGYYFHRFYDHQPDLNTSNPEVQ
AEILKIMGFWIQLGVSGFRMDAAPFIIATKGAEVTKPVEQFDMLRKFREFLQWRMGDSIV
LAEANILPKDNFEYFGDDGDRMQMMFNFQVNQTLFYALATADTRPLKKAMEATKPRPATA
QWGLFLRNHDELDLGRLTDKQRDAVLAAFGPEKGMQLYDRGIRRRLAPMLGGDRRRIELA
YSLLFSLPGTPVIRYGDEIGMGDDLCLPERNCTRTPMQWSMEPEGGFTKSAKPVSPVIKD
GPYGFEHINVAVQRRDPNSLLNWTERMIRMRKEAPEIGWGDFSAVDTGDAGLLALRYDWR
GNSVLILHNLHPHPTEVTFDPDVGELGRLLIDIADGASSEADDKGRHTVMLDAYGYRWYR
VGGLDYLLRRKEI
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgacctctggtataagaacgccgtcatctactgcctgtccgtcgagaccttc
atggatgcgaacggcgacggtgtgggcgatttccagggcctgatgcgccgtctcgactat
ctctccggcctcggcgtgacagcgatctggctcatgccgttccagacgtcgcccggtcgg
gacgacggctacgacgtctccgattactataatgtcgacccacgctatggctcgctcggc
gatttcgtcgagttcacccatggtgccaaacagcggggcatccgggtgttgatcgatctg
gtgatcaatcacacctccaaggatcatccctggttcgaagacgctaggagcgacccgcat
tcacgctatcgcgagtggtacgtctggtcagacaaaaagcccgccaacgcggatcagggc
atggttttcccgggcgtacagaagacgacctggacctatgacgaaaaagctaaaggctat
tattttcatcgcttctacgatcaccagcccgatctcaacacgtccaatcccgaggtccag
gcggagatccttaagatcatgggcttctggatccagctcggcgtctcgggtttccggatg
gacgccgcccccttcatcatcgccacaaagggcgccgaggtcaccaagccggtcgagcag
ttcgacatgctgaggaaatttcgcgaattcctgcaatggcgcatgggagattccatcgtg
ctggcggaggccaatatcctgccgaaggacaatttcgaatatttcggcgacgatggcgac
cgcatgcagatgatgttcaatttccaggtcaatcagacgctgttttatgctctcgccacg
gccgacacgcgacctctgaagaaggcgatggaggccacgaagccgcgcccggcgaccgcg
caatgggggctgtttcttcgcaaccacgatgaactcgatctcggtcgcctgacggataag
cagcgcgacgcggtactcgccgcgtttggacccgagaagggcatgcagctttacgacagg
ggcattcgccggcgcctggcgcccatgctcggcggcgaccgtcgcaggatcgagctggcc
tacagcctgctgttctcgctgcccggaacaccggtcatccgctacggcgatgaaatcggc
atgggcgatgatttgtgcctgccagagcgcaactgcacgcgcaccccgatgcaatggtcg
atggaaccggaaggcggtttcaccaaaagcgcaaagcccgtttcgcctgttatcaaggac
ggcccctacggcttcgagcatatcaatgtcgcggtccagcggcgcgatccgaattcgctc
ttgaactggaccgagcggatgatccggatgcgcaaggaggctcccgagatcggctggggc
gatttctcagcggtcgacacaggtgacgccggcctactggcgctgcgttatgactggcgc
ggcaattcggtgctcatcctgcacaacctgcatccgcacccgacggaagtgaccttcgat
cctgatgttggtgaactcgggcgattgctgatcgatattgccgatggggcaagtagtgaa
gccgacgacaaagggcgccatacggtcatgctcgatgcctatggctaccgctggtatcgg
gtcggcggcctagactatctcctcaggcggaaagaaatctaa

DBGET integrated database retrieval system