KEGG   Rhizobium sp. N1341: AMJ98_CH03126Help
Entry
AMJ98_CH03126     CDS       T04420                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase GroES-like protein
Organism
rhn  Rhizobium sp. N1341
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ANL10760
LinkDB All DBs
Position
3156040..3157068
Genome map
AA seq 342 aa AA seqDB search
MKAVRLQATGQLQLCEVEKPVPGPGELLVRIEACGICGTDRHIFHGEFPSKPPVTLGHEF
AGIVETAGPGVTDFRPGMRVTGDPNISCGSCEECRRGRVNLCRNLRAIGIHRDGGFADYV
CMPQSQAFALPADLDPLHGAFCEPLACCIHGVDLAGLHAGASVIVLGGGVIGLLTLQLAT
LAGATRVVLVTRSAGKRRLAESLGATATADPGDGDIIARLTDADGLLPGGADVVFECAGV
TDTMQQAPRLARRGGSAVILGVMPQGAKIEIEPFDLLFREVRLISSFVNPFTHGRAADLI
ATGRIKVEPLISRRIGLAEAPDAIIKPARGGEIRALVIPGWE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtgcgtctgcaagcgacaggacagttgcagctttgcgaagtcgaaaagccg
gtgccaggcccgggtgaactgctcgtccgaatcgaggcctgtggcatctgcggcaccgac
cgccatatcttccacggcgaatttccgtcgaagccgccggtgacgctcggccatgaattc
gccggcatcgtcgagacggccggaccgggtgtgaccgatttccgccccggcatgcgcgtg
accggcgatccgaacatttcctgcggcagctgcgaggaatgtcggcgcggccgtgttaat
ctctgccggaacctccgggcgatcggcattcaccgcgacggcggcttcgcggattatgtc
tgcatgccgcaaagccaggccttcgcgctgccggccgatcttgacccgctccacggcgcc
ttctgcgagccgctcgcctgctgcattcacggcgtcgatctcgccggattgcacgccggc
gcctcagtcatcgtgctcggcggcggcgtgatcggtctactcaccctccagctggccacg
ctcgccggcgcgactcgcgtcgtgctggtgacgcggagcgctggaaaacgccggctggcc
gaaagcctcggcgccacggcaacagcggatccgggcgacggcgatatcattgcccgtctc
accgacgcggacggactgctgcccggcggcgccgacgtcgtcttcgaatgcgccggcgtc
actgacaccatgcagcaggcgccgcggcttgcccgccgcggcggcagcgccgtcattctc
ggcgtcatgccgcagggggcaaagatcgagatcgagccctttgacttgctgtttcgcgaa
gtccggctgataagctccttcgtcaaccctttcacccatggccgcgccgccgatctgatt
gccaccggcaggatcaaggtcgagccgttgatctcccgcaggatcgggctcgcagaagcc
ccggacgcgatcatcaaaccggcgcgcggcggcgaaatccgggcgctcgtcatccccgga
tgggaatag

DBGET integrated database retrieval system