KEGG   Rhizobium sp. N1341: AMJ98_CH03240Help
Entry
AMJ98_CH03240     CDS       T04420                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rhn  Rhizobium sp. N1341
Pathway
rhn00240  Pyrimidine metabolism
rhn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AMJ98_CH03240 (tdk)
Enzymes [BR:rhn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AMJ98_CH03240 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ANL10866
LinkDB All DBs
Position
complement(3270061..3270645)
Genome map
AA seq 194 aa AA seqDB search
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTVQLIAAFDERAGRGVIGSRIGLEASAI
PFEPDEDLFRLVMTLSGEGAPISCVFVDEAHFMTPLHVWQLARIVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAQGKVLHEGAQIDVGGNEKYV
SLCRRHWDDEMNGA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctatttcaactactcgacgatgaacgccggcaagtcgacgatgctgctg
caggcctcctataattatcaggagcgcggcatgcgtacggtgcagctgatcgccgccttc
gacgagcgcgccggccgcggcgtcatcggctcgcggatcgggctggaggcgagcgccatt
cccttcgaaccggacgaggatctgttccgactggtcatgacgctgagcggcgaaggggcg
ccgatctcctgcgtcttcgtcgatgaggcgcatttcatgacacccctccatgtctggcag
cttgcccgcatcgtcgaccgactcggcatcccggtcatggtgtacgggctgaggacggat
tttcagggcaagctgtttccggcctcacaggagcttttggcgatcgccgacgaaatgcgc
gaggtgcggacgatctgccactgcgggcgtaaggcgacgatggtggtgcggctggacgcg
cagggaaaggtgctgcatgaaggggcgcagatcgatgtcggcggcaatgagaaatatgtc
tctctctgccgcaggcactgggacgacgaaatgaacggggcctag

DBGET integrated database retrieval system