KEGG   Rhizobium sp. N1341: AMJ98_CH03738Help
Entry
AMJ98_CH03738     CDS       T04420                                 

Gene name
suhB-1
Definition
(GenBank) inositol 1-phosphatase 1
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
rhn  Rhizobium sp. N1341
Pathway
rhn00521  Streptomycin biosynthesis
rhn00562  Inositol phosphate metabolism
rhn01100  Metabolic pathways
rhn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rhn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AMJ98_CH03738 (suhB-1)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AMJ98_CH03738 (suhB-1)
Enzymes [BR:rhn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     AMJ98_CH03738 (suhB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase
Motif
Other DBs
NCBI-ProteinID: ANL11345
LinkDB All DBs
Position
complement(3802569..3803369)
Genome map
AA seq 266 aa AA seqDB search
MARSALLNVMVQAALKAGKSLGRDFGEVQNLQVSVKGPGDFVSAADRKAEKIVREELMKA
RPTYGFLGEESEEIKGTDGAHRWIVDPLDGTTNFLHGIPAFAVSIALERNGEIVAAVVFN
PATDELYTAERGGGAFLNDRRLRVAARRVLSDCVVGCGVPALGKRNHGKFLVELRHVMGE
VAGIRRLGSPTLDLAHVAAGRFDGFWEAELAPWDMAAGILLIREAGGFATDWDGGTAILE
GGAIVAGNEHIHKALIEVIKRPIPAK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcccgttcagctcttctcaatgtcatggttcaggctgctctcaaggcagggaaatcg
ctggggcgtgatttcggcgaagtgcaaaacctgcaggtttcggtgaagggaccaggcgat
ttcgtttccgccgccgaccgcaaggccgagaagatcgtccgggaagagctgatgaaggcg
cgtccgacctatggcttcctcggcgaggaaagtgaagagatcaagggcacggacggcgcg
catcgctggatcgtcgacccgctcgacggcacgacgaacttcctgcacggcatcccggcc
ttcgccgtctcgatcgcgctcgaacgcaatggcgagatcgttgccgccgtcgtcttcaat
ccggcgaccgacgaactttacactgccgagcgcggcggcggcgccttcctcaatgaccgg
cgcctgcgcgtcgctgcgcgccgcgtgctgtcggattgcgtcgtcggctgcggtgtgccc
gcgctcggcaagcgcaatcacggcaagttcctggtcgagctgcgccacgtgatgggcgaa
gtggccggcatccgccgcctgggctcgccgaccctcgatctcgcccatgtcgccgccgga
cgtttcgacggcttctgggaggcggagcttgcgccctgggacatggcagccggtatcctg
ctcatccgcgaagccggcggcttcgccaccgattgggatggcggaacggccattctggag
ggcggcgcgatcgtcgccggcaacgaacacatccataaggcgctgatcgaggtcatcaag
cggccgatccccgccaagtga

DBGET integrated database retrieval system