KEGG   Rhizobium sp. N1341: AMJ98_PC00221Help
Entry
AMJ98_PC00221     CDS       T04420                                 

Definition
(GenBank) hypothetical protein
Organism
rhn  Rhizobium sp. N1341
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 Baculo_PEP_C FNIP
Motif
Other DBs
NCBI-ProteinID: ANL12584
LinkDB All DBs
Position
pRspN1341c:complement(238888..239859)
Genome map
AA seq 323 aa AA seqDB search
MYGRRQEGVGNSSEHGGEDTFNWVEGLTGSSSGEAALKEILLAWAEDGQQEQDEDRHEAM
ARIEAWTETRNFRAPLNLASLSLTALPPTLPAGLQRLNANDNRLGRLPNNLPPGLRKLSA
CDNQLTTLPEVLPDMLETLYVDGNRLTRLPNELPSRLKYLYVNHNRLTSLPDNLPPELRE
LHVTRNEIAHLPENLPLELTDLRAELNNIIRLPERLPAKLTRLEVPHNELTSLPEDLPAT
LKWLSTDSNELTHLPPNLPRGLEELSVRGNNLRGLGDGRTALPYILSQLPPHCKVYLNNN
PLPDRLRAHLSAQSGTSLPQIFL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcagaaggcaggagggtgttggcaatagttccgaacacggcggtgaagacacc
tttaactgggttgaaggcttgactggctcctcgtccggcgaagcggcactgaaagaaatt
ttactggcctgggcggaagacgggcagcaggagcaggacgaggaccggcacgaggcaatg
gcacggatcgaggcctggacggaaacccgcaattttcgtgcccccctgaacttagcatcg
ctgtccctaacggcactgccccccaccttaccggccggcctccagcggctcaacgccaat
gacaaccggttgggcaggctgcccaacaacctcccgcccggtctgcgaaagctctctgcc
tgcgacaaccagctgaccacgctgcctgaggttcttccggacatgctcgagacgctctac
gtcgacggcaaccggctgaccagattgccgaacgagcttccttcccgactaaagtatctc
tacgtcaaccacaaccggctgaccagtttgcccgataacctgccgcctgagctcagggag
cttcatgtcacccgcaacgaaatcgcgcacctgccggagaatctccccctcgaattgacg
gatctccgcgccgaactcaataatataattcgcctgcccgagcgccttcctgcaaagctc
acgaggctcgaagtccctcacaatgaactgactagcctacccgaggacctcccggccacc
ctaaagtggctcagcaccgacagtaatgaactgacccacctgccccctaacctgccgagg
gggctggaggagcttagcgttcgtggaaacaacctgagaggacttggcgacgggcgaact
gcactgccgtacattctgtcgcagcttccgcctcattgcaaagtgtacctgaataacaat
ccgctgccagatcgactgcgggcgcacctcagcgcgcaaagcgggacgagccttccgcag
atctttttgtga

DBGET integrated database retrieval system