KEGG   Rhizobium sp. N1341: AMJ98_PE00131Help
Entry
AMJ98_PE00131     CDS       T04420                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rhn  Rhizobium sp. N1341
Pathway
rhn00564  Glycerophospholipid metabolism
rhn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rhn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AMJ98_PE00131 (glpD)
Enzymes [BR:rhn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AMJ98_PE00131 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ANL13356
LinkDB All DBs
Position
pRspN1341e:125028..126539
Genome map
AA seq 503 aa AA seqDB search
MGREIYDIFVIGGGINGCGIARDAVGRGYSVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREILWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PATSVLDMRKDPAGKPLKALFTRAFEYSDGWVDDARMVVLNARDAAEKGATILPRTKVVS
ARRENGLWHIETTDTVTGHNDSHQARMLVNAAGPWVDHVIRSAFGENEAHNVRLVQGSHI
VVKKKFDDPRAYFFQNPDNRIIFAIPYEGEFTLIGTTDRDYTADPKDVRISEEETVYLCN
AASEYFKEPVKPEDIVWTYSAVRPLYDDGASKAQEATRDYVLKLEGEGAAPLLNVFGGKL
TTYRRLSEHALEKIGAAIGIKGAPWTAKSHLPGGNFAVKGYEAEVAKLKSRYPFLADPHA
RRLVRRYGTRAETLLGDARGIEDLGRLFGGDLYEAEVRYLVEHEWARHADDVLWRRTKDG
LRLSKEQAQSLEEYMAAIPAMAG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
ttgggccgggagatatacgacattttcgtcattggcggcggcatcaacggctgcggcatc
gcgcgcgatgccgtcgggcgcggctattccgtggcgctggcggagatgaacgatttcgcc
tccggcacctcatccggcgccaccaagctgatccatggcggcctgcgttatctcgagcat
tacgaattccgcctggtgcgtgaatcgttgatggagcgcgagatcctctgggcgatggcg
ccgcatatcatctggccgctgcgcttcgtattgccgtatcataagggcggtatccgtccc
gcctggctgatccggcttggccttttcctctacgaccatctcggcggccgcaagctgctg
ccggcgacgtcggtgctcgacatgcgcaaggatccggccggcaagccgctgaaggcgctg
tttacgagagcgttcgaatattccgacggctgggtcgacgatgcccgcatggtggtgctg
aacgcccgcgacgccgccgaaaagggtgcgaccatcctgccgcgtaccaaagtggtgtcg
gcaaggcgcgagaacgggctgtggcatatcgagacgaccgataccgtaaccggccacaat
gacagccaccaggcccgcatgctggtcaatgccgccggcccctgggtcgatcacgtcatt
cgttccgccttcggcgagaacgaggcccacaatgtccgcctcgtccagggcagccatatc
gtcgtcaagaagaagttcgacgatccgcgcgcctatttcttccagaatcccgacaaccgc
atcattttcgccattccctatgagggcgagttcaccctgatcggaacgaccgaccgcgat
tacaccgccgatcccaaggacgtccggatctccgaggaggagacggtctacctctgcaat
gcggcgtcggaatatttcaaggaaccggttaagccggaagatatcgtctggacctattcg
gcggtgcggccgctttatgacgacggcgcttcaaaggcgcaggaggcgacgcgcgactat
gtgctgaagctcgagggcgaaggcgccgcgccgctgctcaacgtcttcggcggcaagctc
accacctatcgccggctttccgaacatgcgctggaaaagatcggtgcggcgatcggcatc
aagggcgctccctggacggcaaagagccatctgccgggcggcaatttcgccgtcaagggt
tatgaggccgaagtcgccaagctgaaaagccgttatcccttccttgccgatccgcatgcg
cgccggctggtgcgccgctacggcaccagggccgagacgctgctcggcgatgcccgtggc
atcgaggatctcgggcggctgttcggcggcgatctttacgaagccgaagtcagatatctc
gtcgaacatgaatgggcccggcacgccgatgacgtgctgtggaggagaacaaaggatggt
ctgcgcctttcgaaggagcaggctcagtcactggaggagtacatggctgccataccggcg
atggccggataa

DBGET integrated database retrieval system