KEGG   Rhizobium sp. N1341: AMJ98_PE00520Help
Entry
AMJ98_PE00520     CDS       T04420                                 

Definition
(GenBank) glycosyde hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
rhn  Rhizobium sp. N1341
Pathway
rhn00500  Starch and sucrose metabolism
rhn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMJ98_PE00520
Enzymes [BR:rhn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AMJ98_PE00520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ANL13744
LinkDB All DBs
Position
pRspN1341e:553048..554475
Genome map
AA seq 475 aa AA seqDB search
MTVALWSQSMTGANPAHIGANAPTVKPRPAFAQTDLVALSRYFSLLMMRNITSDGYVIED
PTSPGVFSAPGCVIAAPSYPANTPGVDQDYVFNWVRDGAITAIEIALAGLLPIPGGVLPS
LVDYVNFAALCQANAKNSDTVTLGHACFTITGEVRPWSEQNDGPAIQSIAILTLFDQLDG
ATQTIAKQLVQANLAYLLEVYQNKTTNLWEEYEGYSFFARAVQLRFFREISTNTIGITVP
AGVADAISWLESQLATHWNGQLYVSILDAQEQAGYDANIDIVSSVCYGGIEPTDTKLLAT
AAILRRQWADPSSSNYYPVNGADAAKGLGPLFGRYPGDHYDGDVAAPVAGGHPWALCTAN
FAEFQYRLANAIDASGAIPLDQFSEPFFAELGLGASSSAADASAALRASSDAMLRAIVYH
SDHYELSEQFDGTVGYEKSVRNLTWSYASFLSAVRARAAAPAAKSKPRNSRGPKS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgcgctttggagtcagtcaatgacgggtgcgaacccggcccatatcggcgcc
aatgcgcctacagtcaaaccgaggcctgccttcgcgcagacggatctggtcgcattgtcg
cgctatttttctcttctgatgatgcgcaacatcaccagcgatggctatgtcatcgaggat
cccacatcgcccggcgtcttttcggccccgggctgcgtcatcgccgcaccctcctatcca
gcgaacacgccgggtgtcgaccaggactatgttttcaactgggtccgcgacggggccatt
actgccatcgagatcgcgcttgccggcttgttacccattccgggcggagttttgccgagc
ctggtcgactacgtgaacttcgccgcgctctgccaggcgaatgcgaagaattccgacacc
gtcacacttggccacgcctgcttcaccatcaccggcgaggttcgtccgtggtcggagcag
aatgacgggccggccattcagtcgattgcgatcctgaccctgttcgatcagctggatggc
gccacgcagacgatcgccaaacaactggtccaggccaacctcgcttatcttctcgaagtt
taccagaacaagaccacaaatctctgggaggaatatgagggctattcgtttttcgcaaga
gccgtacagctccgctttttccgggaaatttccacaaacacgatcggcattacggtgcct
gccggggtggccgacgccatctcctggctggaaagccagctggcaacccactggaacggg
cagctctatgtgagcattctggatgcccaggagcaagccggttacgacgcgaacatcgat
atcgtctcttcggtctgctatggcgggatcgagccaaccgataccaagcttctggcaacg
gcggccatcctgcggcgccagtgggccgatccttcgtcttcgaactattacccggtcaat
ggcgccgacgcggccaaagggctcggaccactcttcgggcgctatccaggcgaccattac
gatggcgatgtggcggctccggttgccggcgggcatccctgggctctgtgcaccgccaac
ttcgccgagtttcaatatcggcttgccaatgccatcgatgccagcggcgccatccccctc
gatcagttctccgaacccttcttcgcggaactgggacttggcgcatccagcagcgctgcc
gacgcgtcggctgctttgcgggcttcctctgacgccatgctgcgcgccatcgtctatcac
agcgatcactatgaactgagcgaacagttcgatggaaccgttggctacgagaaaagcgtc
cggaatctgacctggagctatgcctccttcctctcggcagtcagagcccgcgccgccgcc
ccggccgccaagtccaagccccgaaactctcgcggcccgaaatcatga

DBGET integrated database retrieval system