KEGG   Rhodococcus sp. 008: AOT96_02785Help
Entry
AOT96_02785       CDS       T05462                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rhod  Rhodococcus sp. 008
Pathway
rhod03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rhod00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AOT96_02785
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rhod03400]
    AOT96_02785
Enzymes [BR:rhod01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AOT96_02785
DNA repair and recombination proteins [BR:rhod03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AOT96_02785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ANQ74693
LinkDB All DBs
Position
complement(608954..611236)
Genome map
AA seq 760 aa AA seqDB search
MATTDRGQITLDGTTVSVTNLGKILYPESGTTKAEVIDYYTRIAAVMLPHVVGRPGTRKR
WPNGVDGQSFFEKNLASSAPQWLTRASLQHSDRVVTYPIFDSVASLAWLGQQAALELHVP
QWRFDGSERGPATRLVFDLDPGEGVGLTECAEVARSIRDLVATLGWTAYPVTSGSKGIHL
YVPLDRALDGSGASTVAKQIATGLEKLHPDLVTATMARNVRAGKIFVDWSQNNAAKTTIA
PYSMRGRDQPYVAAPRSWDELDDPKLRHLLFDEVLERVESDGDLLGDLDPPVSAAVADTL
THYRNKRSADRTPEPIPAAVTKETAGNTFVIQEHHARRLHYDVRLERDGVLVSWAVPKGV
PTSAGENRLAVHTEDHPLEYATFSGTIPKGEYGGGSMTIWDSGTYETEKWREDEVIVRLS
GKRVQGRFALIRTKGDQWLMHLMKDQNASFGTEFPKNLEPMLATAGTLEGLDSQEWAFEG
KWDGIRVILEYHSGTMSLRSRAGNDKTGDYPSLAGLAEVLDGHDVVLDGEVVAYNDAGVT
DFGLLQRGGEPVFLAFDLLYLDGVSLLRKSYSDRRTVLNALAGKVGELEVPPQIEGTAEN
ALEVSTDAGWEGIVAKRRASVYLPGRRGSSWIKVKNWRTQEVVIGGWRTGQGNRAQGIGA
LLMGIPGEDGLTYVGRVGTGFSDRDLESLLATLEPLRQKESPFGEELPADDRKGAVWVRP
ELVGEVRFMDWTKTERLRHPSWRGLREDKKPGDVVRETVQ
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgacggatcggggtcagatcactctcgacggcacaaccgtgtccgtgaccaat
ctgggcaagatcctctaccccgagagcggcaccacgaaggccgaagtcatcgactactac
acccgtatcgccgcagtcatgcttccacatgtcgtcggtagaccgggcactcgtaagcgt
tggcccaacggtgtggacggtcagtccttcttcgagaagaacctggcgtcgtctgccccg
cagtggctcacgcgtgcgtcgctgcaacattctgatcgcgtcgtcacttacccgatcttc
gattccgttgcatccctggcgtggctggggcaacaggcggcactcgaattacacgttccc
caatggcgattcgacggttccgagcgtggtccggcgacacgactggtattcgatctcgac
ccgggcgaaggcgtcggattgaccgagtgcgccgaggtggcgaggtcgattcgagatctg
gtcgcaactctggggtggactgcctatccggtaaccagtggtagcaagggaattcacctc
tacgttccactggatcgagccttggacggcagcggtgcgtcgactgtcgccaagcagatc
gccaccggactcgagaagcttcacccggatctcgtcaccgcgacgatggctcgaaatgtg
cgggcaggcaagattttcgtggactggagtcagaacaacgcagccaagacaaccattgcg
ccgtactcgatgcgcggtcgcgatcaaccctatgttgccgcgccgcgcagttgggacgaa
ctcgacgatccgaaactacgacatctgttgttcgacgaggttctggagcgcgtcgaatcc
gatggtgatctgctgggcgatctggatccgccggtctcggcggctgtagccgacacgttg
acgcactatcgcaacaagcggtcggccgaccggacgccggagccgatccctgctgcggtg
accaaggagacagcgggcaatacctttgtgattcaggaacatcacgccagacgattgcat
tacgacgttcgcctggagcgggatggtgtgctcgtgtcctgggctgttccgaagggcgtg
ccgaccagtgccggagagaatcggttggccgtgcacaccgaggatcacccgctcgagtac
gccacgttctcgggcacgatcccgaagggggagtacggcggcggttcgatgacgatctgg
gattccgggacgtacgagaccgagaagtggcgtgaagacgaggtgatcgtgcgcctcagt
gggaaacgggtgcagggacgcttcgcgctgatccggacgaagggtgaccagtggttgatg
catctgatgaaggatcagaacgcgagtttcggaacggagtttcccaagaatctcgagccg
atgcttgccaccgctggaacgctcgaaggtctcgactcgcaggagtgggctttcgaagga
aagtgggacgggatccgagtgattctcgaatatcattcgggcacaatgtcacttcgcagt
cgcgcgggtaacgacaagaccggggactatccctcccttgccgggttggccgaggtgctg
gacggtcatgacgtggttctcgacggtgaagtggtggcgtacaacgacgcgggggtcacc
gatttcggtcttctccagcgaggtggggagccggtgttcctggccttcgatcttctgtac
ctcgacggagtgtctttgctgcggaaatcctactcggaccggcgcaccgtgttgaatgcg
ttggcgggcaaggtcggtgagctcgaggtacctccacagatcgagggcacggcggagaac
gcgttggaggtgagtaccgatgccggatgggaagggattgtcgccaaacgtcgtgcatcg
gtctaccttccggggcggcgtgggtcgagttggatcaaggtgaagaactggcgcactcaa
gaggtggtgatcggagggtggcgcaccgggcagggcaatcgagcacaggggatcggggcg
ctgctcatgggaattccgggtgaggatggattgacctacgttgggcgcgtcggtaccggc
ttcagtgatcgcgacttggagtctttacttgcgacactggaaccgctgcgtcagaaggaa
agtccgttcggggaggaacttccagcagatgaccgcaagggtgcggtgtgggtgaggccg
gaactcgtcggtgaggtgcggttcatggattggacgaagaccgagcgtctgcgtcatccg
agttggcgaggtctgcgggaggacaagaaaccgggcgacgtggtgcgggaaacagtgcaa
tga

DBGET integrated database retrieval system