KEGG   Rhodococcus sp. 008: AOT96_04295Help
Entry
AOT96_04295       CDS       T05462                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
rhod  Rhodococcus sp. 008
Pathway
rhod02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rhod00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AOT96_04295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhod02000]
    AOT96_04295
Transporters [BR:rhod02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    AOT96_04295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 FtsK_SpoIIIE AAA_24 AAA_29 AAA_22 NACHT AAA_16
Motif
Other DBs
NCBI-ProteinID: ANQ70160
LinkDB All DBs
Position
complement(922177..923865)
Genome map
AA seq 562 aa AA seqDB search
MRNETHDPLLRALRLLELRPRRVLTAVAAGVATLGSALALAALSAWLITRAWEMPPVLDL
SVAVVAVRALGISRGVFRYLERLTTHDVALRGTTAARSRIYQQLAAGDPAAAAGLRRGDL
LSRTGADVDALGDVVVKALIPIAVSIVLAFAAVGILLFISVPAALILAVALAVSGIAAPW
LSARAARLAEADSSAAAARFSESAVTALDHSAELRVSGRLDQAVSEAVSAENDVVDATDR
AAVPSAFAAAATPLAIGVSVLGALLIGISLYGTTDMSPMSMGILVLLPLSAFEGTAILPS
AAVALTKARLASARIMAVLDRADAEHVEGNRAWPEDGVLSVHALRAGWPGGKVTEPLSVD
LPRGARVAVVGESGSGKTTALMTMAGLLPPIAGTVRVGVVDVSEVDPAELRRHVGYFAED
AHLFETSVLENLRVARGDLTAEDAEKALAAVGLGDWLSELPEGLDTYLVGGMRAVSGGER
RRLLLARAIVSPAEVLLLDEPTEHMDAEAGDQLLRELLSRDATLVDSSRTVVVVTHQLPD
GTPADQVICVGKVSVENTLPSS
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatgaaactcacgatccgctcctgcgtgctctgcggctactggaacttcggcca
cgacgcgtactgacggcggtagcggcgggtgtggcgacactcggtagcgcactcgccttg
gcggcgctgtccgcatggttgatcacgcgggcttgggagatgcctcccgttctcgacctc
agtgtcgctgtggttgccgtacgcgcgttgggaatctcgcgtggtgtcttccgctacctc
gagcgattgacgacgcacgacgtcgcgttgcgcggaaccaccgcggcgcgatcgaggatc
taccagcagttggccgcaggagatcccgcggcagcagccggactacgacgcggtgacctg
ctctcacgtacgggcgccgacgtggatgcactgggcgacgtcgtcgtcaaagcactgatc
ccgattgcggtctcgattgtcctcgcgtttgctgcggtgggaatcctgttgttcatctcg
gttccggccgcgctcatcctggctgttgcgctggcggtgtccgggatcgcggcaccctgg
ctgtcggctcgtgctgctcgtctcgccgaggccgacagttctgctgccgcagcgcgattc
agtgagtccgcggtgaccgccctcgaccattccgccgagctccgggtatcgggtcgcttg
gaccaggcggtgagcgaggcggtctctgccgagaacgatgtggtcgacgcaaccgatcgc
gcggcggtcccgagtgcctttgccgccgctgccacgcccctggcaatcggagtgagcgtc
ctcggtgccctgctgatcggaatctcgctgtacggaaccaccgacatgtcaccgatgtcc
atgggaatccttgtactgcttccgctgtcggctttcgaaggaaccgcgatactgcccagc
gcggcggtggcactgaccaaggcgaggctggcgtcggcacgcatcatggcggtactcgat
cgagccgacgccgaacacgttgaaggaaatcgtgcgtggccggaggacggggtcctgagt
gtgcacgcgttgcgggcgggttggcccgggggaaaggtgaccgaaccgctgtcggtggat
cttcctcgcggtgctcgtgttgccgtcgtcggcgagagcggatccggaaagaccaccgcg
ctgatgacgatggcgggactgctgccgcctatcgcgggaacagtgcgcgttggcgtagtg
gatgtttcggaagtcgatccggccgaactgcgcaggcacgtcgggtacttcgccgaagac
gcacacctcttcgagacgtcggtactcgagaacctgcgcgtcgcgcggggtgacctcacc
gccgaggacgcggagaaggcacttgccgcagttggtctcggcgactggctgtcggaactg
ccggaagggctcgacacctacctggtcggcggcatgcgagcggtttcgggcggtgagcgt
cgtcggttgctgttggcgcgcgcgatcgtctcgcccgcggaggtactgctgctcgacgag
ccgaccgagcacatggacgcggaggcgggcgatcagttgctccgcgagttgctcagtcgc
gacgcaacgctggtcgattcttcgcgaaccgttgttgtcgtcacccaccaacttccggac
ggcacaccagctgaccaggtgatatgcgtcggaaaagtttctgtggaaaatacgttgccg
tcatcgtga

DBGET integrated database retrieval system