KEGG   Rhodococcus sp. 008: AOT96_04935Help
Entry
AOT96_04935       CDS       T05462                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
rhod  Rhodococcus sp. 008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ANQ70274
LinkDB All DBs
Position
complement(1050881..1051927)
Genome map
AA seq 348 aa AA seqDB search
MELPLMPPLAPMLAKAAATVPPQPESGDPTWSYEPKWDGFRAIIFRDGDEVVLGSRGGKD
LARYFPEAVEAVKSELPEKCVVDGELVVPREIDGVTRLSWEALSERIHPAASRVALLSEQ
TPAQFVGFDLLALGDRDVSIEDFGVRRALLLDCIGGGPSCHVTAATADSAEAMAWFETFE
GAGLDGVVAKKLAGPYLPNKREMIKVKHARTADVVLLGYRPHKSQPGIGSMLLGLYDGSE
LKMVGGASAFTAARRIELLAELEPLRLGDGVVAEGEASRWRSAADRSWIPLRPERVLEVA
YDQMEGERFRHAARFLRSRPDRVPDECTFDQLEVPVRYDFADVLAGGK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtggagctacccctgatgccgccgcttgccccgatgctcgcgaaggctgcggccactgtg
ccgcctcagcccgagtccggtgacccgacgtggtcgtacgagccgaaatgggacggattt
cgagcaatcatctttcgtgacggtgacgaagtggtgctcggatcgcgaggaggaaaggac
ctggcgcggtactttcccgaagcggtggaagctgtcaagtctgaattgcccgaaaaatgt
gtcgtggacggagaactggtggttccccgtgagatcgacggtgtgacgcgtctgagttgg
gaagcgctctccgagcggattcatcccgccgcgagccgcgtcgcattgttgtcggaacag
acgccagcgcaatttgtcgggttcgatttactggcgctcggcgatcgcgacgtctcgatc
gaggacttcggggtccgacgtgcgctgctcctcgattgcatcggtggcgggccgagttgc
cacgtcacggcagcgacggcagacagcgccgaagcaatggcctggttcgaaaccttcgaa
ggcgcgggtctcgacggggttgtcgccaagaagctggcgggaccgtacctgccgaacaag
cgcgagatgatcaaggtgaaacacgccaggaccgcggatgtcgtactgctgggctaccgt
ccccacaagagtcagccaggtatcgggtcgatgcttcttggtctgtacgacggttccgaa
ttgaagatggtcggtggcgcttctgctttcaccgcggcgcggcggatcgagttgttggcc
gaactcgaacctttgcgcctcggggacggcgttgtagccgagggagaggccagccggtgg
agatcggccgcagaccgctcctggattccgcttcgtcctgagcgggtgctcgaagtggcg
tacgaccagatggaaggggaacgctttcggcacgctgcacgattcctgcgctcgcgtccg
gacagggtgcccgacgaatgcacattcgatcagttggaggttccggtgcgatacgacttc
gcggatgttcttgcaggcggtaagtga

DBGET integrated database retrieval system