KEGG   Rhodococcus sp. 008: AOT96_06790Help
Entry
AOT96_06790       CDS       T05462                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
rhod  Rhodococcus sp. 008
Pathway
rhod00250  Alanine, aspartate and glutamate metabolism
rhod00280  Valine, leucine and isoleucine degradation
rhod00310  Lysine degradation
rhod00410  beta-Alanine metabolism
rhod00640  Propanoate metabolism
rhod00650  Butanoate metabolism
rhod01100  Metabolic pathways
rhod01120  Microbial metabolism in diverse environments
Module
rhod_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rhod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AOT96_06790
   00650 Butanoate metabolism
    AOT96_06790
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AOT96_06790
   00280 Valine, leucine and isoleucine degradation
    AOT96_06790
   00310 Lysine degradation
    AOT96_06790
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AOT96_06790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhod01007]
    AOT96_06790
Enzymes [BR:rhod01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AOT96_06790
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AOT96_06790
    2.6.1.48  5-aminovalerate transaminase
     AOT96_06790
Amino acid related enzymes [BR:rhod01007]
 Aminotransferase (transaminase)
  Class III
   AOT96_06790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ANQ74781
LinkDB All DBs
Position
complement(1433599..1434975)
Genome map
AA seq 458 aa AA seqDB search
MSVSSVTGGPLVSQHRELVTAIPGPQSQVLMRRKEAAVAAGVGHVVPISIVAAGGGILID
ADGNSLIDLGSGIAVTGVGNSAPAVVEAITRQAKLFTHTCFTVTPYDGYVAVAEKLNSIT
PGDHEKRTALFNTGSEAVENAIKIARSFTNKHAVVVFDHAFHGRTNLTLGMTAKNTPYKN
GFGPFTPEIYRVPTSYPYRDGLSGVAAAEIALLQIERQVGASNLAAIVIEPIQGEGGFIE
PATGFLPALSEWATANGVVFILDEVQTGFARTGDLFAANHERVVPDLIATGKGIAGGLPL
AAVTGRAEIMDSPQSGALGGTYAGNPISCAAALATIETYEKNDLVVRAREIAAIIDEVFT
ELGASDDRIGDIRGRGAMKAIEVVHPDSTDPNPALTASVAKFAADHGVVVLTCGTYGNVI
RFLPPLAISDELLREGLRVVADGFRAHPPTSATKESQS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagtctcgtcagtaacaggcggcccactggtgtcgcaacacagagaactcgtaacc
gcaattccaggaccgcaatcgcaggtgctcatgcgtcgaaaagaggcggccgttgcggcc
ggtgtagggcacgttgtacccatatcgatcgtcgcagccggaggcggcatcttgatcgat
gccgacggcaattctctgatcgatctcggttcgggcattgccgtcaccggcgtcggcaat
tcagctccagccgttgtcgaagccataactcgccaagcgaaactgttcactcacacctgc
ttcaccgtcaccccatacgacggctacgttgcggtcgctgagaaactcaactcgatcacc
cccggtgaccacgagaagcgcacagcactgttcaacaccggttccgaagccgtcgagaac
gcgatcaagatcgcacgctccttcaccaacaaacatgcggttgtggtcttcgatcacgcg
ttccacggcagaaccaacctcaccttgggcatgactgcgaagaacaccccttacaaaaac
ggcttcggtccgttcacgcccgagatctaccgtgttccaacctcgtacccatatcgcgat
gggctgagcggagtggcggcggcagaaattgcgctcctgcagatcgaaagacaggtcggc
gcttccaatctcgcagcaatcgtcatcgagcccatccagggcgagggtggattcatcgaa
cccgcgaccggttttctgcctgctctatccgaatgggcaactgccaacggcgtcgtattc
atcctcgacgaagtccaaaccgggttcgcccgtaccggtgatctcttcgctgcgaaccac
gagcgagtcgtacctgatctcatcgcaacaggaaaaggtatcgcgggtggattgccactg
gccgcggtcactggccgcgcagagatcatggactcgccacaatccggcgctctcgggggc
acctacgccggaaacccaatctcctgcgccgcggcgctcgccacaatcgaaacgtacgaa
aagaacgacctggttgttcgtgcacgtgaaatcgcggcgatcatcgatgaggtcttcacc
gaactgggcgcctcggacgaccgtattggtgacatccgcggccgcggcgcgatgaaggcc
atcgaagtagtacaccccgacagcacagatccgaacccggcgctgaccgcttccgtcgca
aaattcgccgcggatcatggcgtagtggttcttacgtgcggcacctacggaaacgtcatc
cgatttctccctccgctcgcaatttcggacgaactgctacgcgaaggtctacgcgtcgtg
gccgacggattccgtgcgcaccccccgacctcagccacaaaggaaagccagtcatga

DBGET integrated database retrieval system