KEGG   Rhodococcus sp. 008: AOT96_10660Help
Entry
AOT96_10660       CDS       T05462                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
rhod  Rhodococcus sp. 008
Pathway
rhod00071  Fatty acid degradation
rhod00280  Valine, leucine and isoleucine degradation
rhod00281  Geraniol degradation
rhod00362  Benzoate degradation
rhod00592  alpha-Linolenic acid metabolism
rhod01100  Metabolic pathways
rhod01110  Biosynthesis of secondary metabolites
rhod01120  Microbial metabolism in diverse environments
rhod01130  Biosynthesis of antibiotics
rhod01212  Fatty acid metabolism
Module
rhod_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rhod00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOT96_10660
   00592 alpha-Linolenic acid metabolism
    AOT96_10660
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOT96_10660
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    AOT96_10660
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOT96_10660
   00642 Ethylbenzene degradation
    AOT96_10660
Enzymes [BR:rhod01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     AOT96_10660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ParE_toxin
Motif
Other DBs
NCBI-ProteinID: ANQ71269
LinkDB All DBs
Position
complement(2267263..2268372)
Genome map
AA seq 369 aa AA seqDB search
MNNEVVIVDAMRSPLTQRPMYGRAHRELRTEELLDVTVSGLLHRAKINEDEVTTIVTVGD
RAAAFLQAESWSKAFQRIELHDAVSATAAIQFANNVIKSDPRKVVLVAGAASGNSWFDVP
NARMKMPAQPADQWRITRQSESEFASASHQRARECALSGDFRRELIPLELHVDLEVTEFV
ASDELRQGAETPGALRLAPHPATNLTSQAESLTCQLPHHYANAAKGAGALVLTSASRADE
LGIHPRGRLVGVEILFDSDLENASTSELDLVRSYLRQHGVSPDCIDQYEVPEDTARGPLI
WLTEFGINTYMLNPRGGALAFGHLAELEGIRALATMLSALEDTGGIYGLVATSSVDGSGV
ILVECSHNP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgaagtcgtaatcgtggacgcaatgcgctccccgctgacacagcgacccatg
tacgggcgagctcaccgtgagctccgcacagaggaactgctggatgtcacggtcagcggc
ctacttcaccgtgcgaaaatcaatgaagacgaggtcaccacgatcgtcaccgtaggagac
agggcggctgcattcctacaagccgagtcgtggagcaaagcattccagcgtatcgagtta
cacgatgcggtatctgcaactgccgcaatccaattcgcgaacaatgtgatcaaaagtgat
ccaagaaaagttgtgctagtggccggcgcagcgagtggcaactcctggttcgatgttcca
aacgcgagaatgaaaatgccggcgcaacccgcggatcaatggcgcatcacacgacagagc
gagagcgagttcgcatcggcttcgcaccaacgcgcccgtgaatgtgcgttatcgggtgat
ttccgccgtgagctcattccactcgagttgcacgtcgatctcgaggtgaccgagttcgtc
gcgagtgatgagcttcgacaaggagccgagacgcccggtgcacttcgtctggcgccccac
ccagcaacaaacctgacttcgcaggctgaaagtctcacctgccagctccctcatcactat
gccaacgctgcgaaaggtgctggtgcgctcgttcttaccagcgccagccgcgctgacgaa
cttggaatccatccccgggggcgtctagttggcgtcgaaattttgttcgattcggacctt
gaaaatgcatctacatccgagctcgatttggttcggtcatatcttcggcagcatggggtt
tctcccgactgcatcgaccagtacgaagtgcccgaggatactgccagaggccccttgatc
tggcttacggagttcgggataaatacctacatgctgaatccccgcggtggggcgctggct
tttgggcatctggccgagctcgaaggtattcgcgcattggccaccatgctcagcgcctta
gaggacacagggggaatctatggacttgtggccacgtcgagcgttgacggatccggcgta
attttggtggagtgctcgcataacccttga

DBGET integrated database retrieval system