KEGG   Rhodococcus sp. 008: AOT96_15600Help
Entry
AOT96_15600       CDS       T05462                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rhod  Rhodococcus sp. 008
Pathway
rhod00220  Arginine biosynthesis
rhod00250  Alanine, aspartate and glutamate metabolism
rhod00290  Valine, leucine and isoleucine biosynthesis
rhod01100  Metabolic pathways
rhod01110  Biosynthesis of secondary metabolites
rhod01130  Biosynthesis of antibiotics
rhod01210  2-Oxocarboxylic acid metabolism
rhod01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rhod00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AOT96_15600
   00290 Valine, leucine and isoleucine biosynthesis
    AOT96_15600
   00220 Arginine biosynthesis
    AOT96_15600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhod01007]
    AOT96_15600
Enzymes [BR:rhod01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AOT96_15600
    2.6.1.66  valine---pyruvate transaminase
     AOT96_15600
Amino acid related enzymes [BR:rhod01007]
 Aminotransferase (transaminase)
  Class I
   AOT96_15600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Aminotran_MocR Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ANQ72118
LinkDB All DBs
Position
complement(3357448..3358668)
Genome map
AA seq 406 aa AA seqDB search
MNTPIDQARKLENVRYDIRGRILDKTEELEDQGHTILRLNVGNPAPFGFEAPDEIMMAMI
RNLPTAQGYCDSRGLYSARTAVVQYYQTRGITDVTVDEIYLGNGVSELITLTMQALCNPE
DEILIPAPDYPLWTASVSLAGGTPVHYLTDESQGWAPDFDDLEARITPRTRGIVVINPNN
PTGAVYSTEVLQRFVDLARKHDLMLFADEIYEKIVYDGRSMTNLATMTGRDVLCLTYSGL
SKAYRVCGFRAGWLAVTGPLERASSFIEGIKLLANMRMCANVPAQHAIQTALGGRQSIED
LLLPQGRLTAQRDLAHTTLNSIDGISCQQADGALYLFPKLDVDKFGIVDDERFVLDLLES
EKILVSHGRAFNWIEPDHFRLVTLPNTDDLSTALERLGNFLSSYSQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacacccatcgatcaggcccgcaagctcgagaatgtcaggtacgacatcagaggg
cgaattctcgacaagaccgaagaactcgaggatcagggacacacgatcctgcgactcaac
gtcggcaatccggcccccttcgggttcgaagctccggacgaaatcatgatggccatgatc
cgcaatctccctaccgcgcagggatattgcgattctcgcggactgtattcggcgcgcact
gcggtggtccagtactaccagacgcggggtatcaccgacgtcaccgtcgacgagatctat
ctcggaaacggtgtgtccgaactgatcaccctgacgatgcaggccctctgcaatccagag
gacgagatcctgattcccgctcccgactatcccttgtggacggcttcggtttcacttgcc
ggcggcacgcccgtccactacctcaccgatgaaagccaaggctgggcaccggacttcgac
gatctggaagctcggatcacgccgcgcacccgagggattgtcgtcatcaatcccaacaat
ccgacgggcgccgtctactcgacggaggtgctgcaacgcttcgtggatctagcgcgcaaa
cacgatctgatgctcttcgccgacgagatctacgaaaagatcgtctacgacggccgatcc
atgacaaaccttgcgacgatgaccgggcgagacgttctgtgtctgacgtattcgggactg
tccaaggcctaccgcgtgtgcggattccgagccggatggctggccgtcaccgggccactc
gagcgggcgtcgagcttcatcgaaggcatcaaattgctggccaacatgcgaatgtgtgcc
aacgtgccggcgcagcacgctatccagactgcactcggcggacgacagtccatcgaggac
ctgttgcttccacaaggtcggctgacggcccagcgcgatctcgcacacaccacgctcaac
agcatcgacgggatcagttgccaacaggccgacggggcgctgtacctgttccccaagctc
gacgtcgacaagttcggcatcgtcgacgacgagaggttcgttctcgatctactggaatcg
gagaagattctcgtcagccacggtcgcgcgttcaattggatcgaacccgatcacttccgg
ttggtgactctccccaacaccgacgatctctcgacggcactcgagcgactcggcaacttc
ctcagttcctacagccagtag

DBGET integrated database retrieval system