KEGG   Rhodococcus sp. 008: AOT96_15845Help
Entry
AOT96_15845       CDS       T05462                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
rhod  Rhodococcus sp. 008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ANQ72161
LinkDB All DBs
Position
complement(3409371..3410816)
Genome map
AA seq 481 aa AA seqDB search
MTDYDKLYIGGAWVAPATDQVLEVFSPATEERVGSCPIAAPADIDAAVSAARAAFEGPWS
RTTPAERGAILAKAAKLIEERSAEINQLISNEMGQPPAMVGMMQQTPSMATLGYYAELAD
KFAWEEKRTGAFGQTKVTREPVGVVAAVLAWNVPLFLAINKLAPALLAGCTVLLKPAPES
PLSVHVIAEIFTEAGVPEGVISVLPGGAETGEYLVSHAGIDKITFTGSSAVGRKIGAIAA
QNLKRCSLELGGKSAAIILEDADIAAGMPMLVMSGLMNTGQACVAQTRILAPRSRYDEVI
EGMKTAAGFMTVGDPSDPAAQLGPLISEKQRERVEGYIAKGKEEGARVVLGGGRPAGLDK
GWYVEPTIFADVDNSMTIAREEIFGPVLSVIPYDSEDEAIKIANDSDYGLAGSVWTTDID
HGLEVAAQIRTGTYAINWYAFDPGSPFGGYKNSGIGRENGPEGLEAFCETKSVLMPPGYV
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgactgactacgacaagctctacatcggtggagcatgggtggccccggccaccgaccag
gtactcgaagtgttctctcccgcaacggaggagcgcgtcggcagctgtcccatcgcagca
ccggcagacatcgacgcggccgtgtccgcagcccgcgcggcgttcgagggaccgtggtca
cgcaccacccccgccgagcgcggcgcgatcctcgccaaggccgccaagctgatcgaagag
cgcagcgcggagatcaaccagctcatctccaacgagatgggccagccgcccgccatggtc
ggcatgatgcagcagaccccgtcgatggcgacgctgggctactacgccgagctggccgac
aagttcgcgtgggaagagaagcgcaccggcgcattcgggcagaccaaggtgacccgtgag
cccgtcggcgtcgtcgccgccgtgctggcctggaacgtcccgctgttcctggcgatcaac
aagctggcccccgcactgctcgccggctgcaccgtactgctcaagcccgcacccgaatcc
cctctctctgtccacgtgatcgccgagatcttcaccgaggcaggcgttcccgaaggcgtc
atctccgtgctccccggcggagccgagaccggcgaatatctggtctctcatgcgggcatc
gacaagatcacgttcaccggatccagtgccgtcggccgcaagatcggtgccatcgccgca
cagaacctcaagcgctgctccctcgaactgggtggcaagtccgccgcgatcatcctcgag
gacgccgacatcgccgccggaatgccgatgctcgtcatgtccggcctgatgaacaccggt
caggcctgtgtcgctcagacccgaatcctcgctccccgttcgcgttacgacgaggtcatc
gagggaatgaagaccgccgcaggcttcatgaccgtcggcgatccgtccgatcccgcagca
caactcggcccgctgatctccgagaagcagcgcgagcgcgtcgagggttacatcgccaag
ggtaaggaagaaggcgcgcgcgtcgtactcggtggtggacgccccgccggcctggacaag
ggctggtacgtcgagccgacgatcttcgccgacgtggacaactcgatgaccatcgcacgc
gaggagatcttcggacccgttctctcggtgatcccgtacgactccgaggacgaggccatc
aagatcgccaacgattcggattacggcctcgccggatcggtgtggaccaccgacatcgat
cacggactcgaagttgccgcgcagatccgcacgggtacctacgcgatcaactggtacgcc
ttcgatcccggatcaccgttcggtggttacaagaactccggtatcgggcgcgagaacgga
cctgagggcctcgaagccttctgcgagaccaagtccgtactcatgccgcccggctacgtg
ggctga

DBGET integrated database retrieval system