KEGG   Rhodobacter sp. LPB0142: LPB142_01285Help
Entry
LPB142_01285      CDS       T04631                                 

Definition
(GenBank) dimethlysulfonioproprionate lyase DddL
  KO
K16953  dimethylpropiothetin dethiomethylase [EC:4.4.1.3]
Organism
rhp  Rhodobacter sp. LPB0142
Pathway
rhp00920  Sulfur metabolism
rhp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhp00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    LPB142_01285
Enzymes [BR:rhp01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.3  dimethylpropiothetin dethiomethylase
     LPB142_01285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMSP_lyase Cupin_7 Cupin_2
Motif
Other DBs
NCBI-ProteinID: AOZ70809
UniProt: A0A1D9MGB9
LinkDB All DBs
Position
253539..254225
Genome map
AA seq 228 aa AA seqDB search
MTDCPDWLYLLEEFDALYRQGSAGGSGPIRAHRKRVRDALAMILDANPEISGRPPEVKPV
TAHLGRALDLGERGAGQGLSRALARVADGLTWEYGYEKVPKALARKYAYCEILGPRGPIR
AERLILGFVLFAPGTTYPQHSHKEIEESYISVAGAWSQNDAAVHAPGSLIFNRPGLEHRI
TTDELSPCLLAYAWIGPEARLSQPGMKLSSPRRSPSRAAPATALSDAR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ctgacggattgccccgactggctctacctgcttgaggagttcgacgcgctctaccggcag
ggctcggcggggggcagcgggccgatccgcgcgcatcgcaaacgcgtgcgcgacgcgctt
gcgatgatcctcgatgccaaccccgagatctcggggcgcccgcccgaggtcaagccggtc
acggcccatctcggccgtgcgctcgatcttggcgaacggggcgcggggcagggcctgtcg
cgggcgctggcgcgggtcgccgacgggctcacttgggaatatggctatgagaaggttccg
aaggcgctcgcgcgcaaatatgcctattgcgagatcctcgggccgcgggggccgatccgc
gccgagcggctgatcctcggctttgtgctcttcgcgccgggcaccacctacccgcaacac
agccacaaggagatcgaggagagctatatctcggtcgcgggggcctggtcccagaacgat
gcggccgtccatgcgccggggtcgctgatcttcaaccggccgggcctcgaacaccggatc
accaccgacgagctgagcccctgcctgctggcctatgcctggatcgggccggaagcgcgg
ctgagccagccgggcatgaagctcagctcgccgcgccggtctccttctcgagcagcccct
gcaacagcgctatccgacgcgcggtga

DBGET integrated database retrieval system