KEGG   Rhodobacter sp. LPB0142: LPB142_03070Help
Entry
LPB142_03070      CDS       T04631                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rhp  Rhodobacter sp. LPB0142
Pathway
rhp00250  Alanine, aspartate and glutamate metabolism
rhp00410  beta-Alanine metabolism
rhp00640  Propanoate metabolism
rhp00650  Butanoate metabolism
rhp01100  Metabolic pathways
rhp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LPB142_03070
   00650 Butanoate metabolism
    LPB142_03070
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LPB142_03070
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LPB142_03070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhp01007]
    LPB142_03070
Enzymes [BR:rhp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LPB142_03070
Amino acid related enzymes [BR:rhp01007]
 Aminotransferase (transaminase)
  Class III
   LPB142_03070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOZ70850
UniProt: A0A1D9MGF8
LinkDB All DBs
Position
619660..620943
Genome map
AA seq 427 aa AA seqDB search
MTVQTSPELSARKDAAIAKGVGMSTQIYAARAENAEIWDKNGTRFIDFAAGIAVVNTGHR
HPKVIEAVKAQLDAFTHTCHQVVPYENYVVLAERLNAKVPGDFTKKTIFTTTGAEAVENA
IKIARHYTGRAGVIAFAGGFHGRTFMTMTLTGKVQPYKAGFGPMMNDVWHLPYPNALHGV
SMEDAIASLERLFKADVEPSRVAAIILEPVQGEGGFVPAPEGFMKKIREICDKHGIVMIA
DEVQTGFARTGKLFAMEHHGVAADITTMAKGLGGGLPISAVTGRAEIMDHAQPGGLGGTY
AGNPLGVAAANAVLDVIEEEDLPARAERLGARLKQRLAAIADQVPEIVEIRGPGFMNAVE
FNVAGTDTPNPDFVKRVLAEALDRGLILLSCGVYGNVIRFLAPLTIPEPVFEEALEILEA
SILAAKG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgactgtccagacctcgcccgaactttccgcccgcaaggacgccgccatcgccaaaggc
gtcggcatgtccacccagatctacgccgcccgcgcggaaaatgccgagatctgggacaag
aacggcacccgtttcatcgatttcgccgccggcatcgcggtggtgaacaccggccaccgc
cacccgaaggtgatcgaagccgtcaaggcccagctcgacgccttcacccacacctgccac
caggtcgtgccctatgagaactacgtcgtgctcgccgaacggctgaacgccaaggttccg
ggcgatttcaccaagaagacgatcttcaccaccaccggcgccgaagccgttgaaaacgcg
atcaagatcgcgcgtcactacaccggccgcgcgggcgtcatcgccttcgccggcggcttc
catggccggaccttcatgaccatgacgctgaccggcaaggtccagccctacaaggccggt
ttcggcccgatgatgaacgatgtctggcacctgccctacccgaacgcgctgcatggcgtg
tcgatggaggacgcgatcgcctcgctcgagcgcctcttcaaggccgatgtcgagccctcg
cgcgttgccgcgatcatcctcgagccggtgcagggcgagggcggcttcgtgcccgcaccc
gaaggcttcatgaagaagatccgcgagatctgcgacaaacatggcatcgtgatgatcgcc
gatgaagtgcagaccggctttgcccgcaccggcaagctcttcgcgatggagcaccacggc
gtcgccgccgatatcaccaccatggccaagggcctcggcggcggtctgccgatctcggcg
gtcaccgggcgcgccgaaatcatggatcacgcccagccgggcggcctcggcggcacctat
gccggcaacccgctcggcgtcgccgcggccaatgccgtgctcgacgtgatcgaggaagaa
gacctgcccgcccgcgccgaacgcctcggcgcgcgcctcaagcagcgcctcgccgcgatc
gccgatcaagtgccggaaatcgtcgagatccgcggcccgggcttcatgaacgcggtcgaa
ttcaacgtcgcgggcaccgacactccgaacccggatttcgtcaaacgcgttctggccgag
gcgctcgaccgcgggctgatcctgctgtcgtgcggcgtttacggcaacgtgatccgcttc
ctcgcgccgctcaccatccccgagccggtcttcgaggaagccctcgagatcctcgaggcg
tcgatcctcgcggcgaagggctga

DBGET integrated database retrieval system