KEGG   Rhodobacter sp. LPB0142: LPB142_04600Help
Entry
LPB142_04600      CDS       T04631                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rhp  Rhodobacter sp. LPB0142
Pathway
rhp00240  Pyrimidine metabolism
rhp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LPB142_04600
Enzymes [BR:rhp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LPB142_04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AOZ68683
UniProt: A0A1D9MA18
LinkDB All DBs
Position
complement(935471..936052)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFNYSTMNAGKSTILLQASHNYIERGMQTLLVTARIDARAGAGRIASRIGIGAEAT
TFGPEDDMFEMVKSRRDAGPLACVFVDEAQFLTKDQVWQLARAVDDLGIPVMCYGLRVDF
RGELFPGSAALLALADEMREVRTICHCGKKATMVVRKDAMGRAAREGDQVQIGGNETYVS
LCRRHWREAVGDL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggccaaactctacttcaactattcgacgatgaacgcgggcaagagcacgatcctcttg
caagcctcgcacaattatatcgagcgcgggatgcagaccctcctcgtcaccgcgcggatc
gatgcgcgggcgggcgcgggccggatcgcgagccggatcggcatcggcgccgaggccacg
accttcgggcccgaagacgatatgttcgaaatggtcaagtcgcggcgcgatgcggggccc
ctcgcctgcgtctttgttgatgaagcgcaattcctgacgaaggatcaggtctggcaactc
gcgcgcgcggtcgatgatctcgggatcccggtgatgtgctacgggctgcgggtggatttc
cggggcgagctgttccccggctcggcggcgctgctggcgctcgccgacgagatgcgcgaa
gtgcgcacgatctgccattgcgggaagaaggcgacgatggtggtgcgcaaggatgccatg
gggcgcgccgcgcgcgagggcgaccaggtgcagatcggcggcaatgagacctatgtctcg
ctctgccgccgccactggcgagaagcggtgggcgatctctga

DBGET integrated database retrieval system