KEGG   Rhodobacter sp. LPB0142: LPB142_05310Help
Entry
LPB142_05310      CDS       T04631                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
rhp  Rhodobacter sp. LPB0142
Pathway
rhp00061  Fatty acid biosynthesis
rhp01100  Metabolic pathways
rhp01212  Fatty acid metabolism
Module
rhp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rhp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LPB142_05310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rhp01004]
    LPB142_05310
Enzymes [BR:rhp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     LPB142_05310
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     LPB142_05310
Lipid biosynthesis proteins [BR:rhp01004]
 Fatty acid synthase
  Component type
   LPB142_05310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA DUF5608
Motif
Other DBs
NCBI-ProteinID: AOZ68807
UniProt: A0A1D9MAE3
LinkDB All DBs
Position
1067025..1067534
Genome map
AA seq 169 aa AA seqDB search
MANYPTSFGKEDLLKCARGELFGPGNAQLPAPPMLMMDRITEISGDGGLHGKGHVVAEFD
ITPDLWFFDCHFPGNPIMPGCLGLDGLWQLTGFNLGWRGWTGRGYALGVGEVKLTGMVRP
DRKMLTYKVDFTKAVQTRRLTMGVADGIVEADGEVIYMVKDMKVALSES
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcaaactatccgacgagcttcggcaaggaagatcttctgaaatgcgcgcgtggcgag
ctgttcgggccgggcaatgcccagcttccggcgccgccgatgctgatgatggaccgcatc
accgagatctcgggcgatggcgggctgcatggcaagggccatgtcgtcgcggaattcgac
atcacgccggatctgtggttcttcgactgccacttccccggcaacccgatcatgccgggc
tgcctcgggctcgacgggctgtggcagctcaccggcttcaacctcggctggcgcggctgg
acggggcggggctatgcgctcggcgtcggcgaggtcaagcttaccggcatggtgcgcccc
gatcgcaagatgctgacctacaaggttgatttcaccaaggccgtgcagacccgccggctg
accatgggcgtcgccgacggtatcgtcgaggccgatggcgaggtgatctacatggtcaag
gacatgaaggtcgcgctctccgagagctga

DBGET integrated database retrieval system