KEGG   Rhodobacter sp. LPB0142: LPB142_06660Help
Entry
LPB142_06660      CDS       T04631                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rhp  Rhodobacter sp. LPB0142
Pathway
rhp00061  Fatty acid biosynthesis
rhp00780  Biotin metabolism
rhp01100  Metabolic pathways
rhp01130  Biosynthesis of antibiotics
rhp01212  Fatty acid metabolism
Module
rhp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rhp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LPB142_06660
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LPB142_06660
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LPB142_06660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rhp01004]
    LPB142_06660
Enzymes [BR:rhp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     LPB142_06660
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     LPB142_06660
Lipid biosynthesis proteins [BR:rhp01004]
 Fatty acid synthase
  Component type
   LPB142_06660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AOZ69043
UniProt: A0A1D9MB36
LinkDB All DBs
Position
complement(1340956..1341777)
Genome map
AA seq 273 aa AA seqDB search
MANTLMAGKRGLIMGLANDKSIAWGIAKALGNAGAELAFSYQGEALKKRVEPLAAQLGSD
ILVECDVADQGSLDRLFETLKEKWGTLDFVVHAIGFSDKNELRGRYVDTSPANFAMTMDI
SVYSFTAVCKRAAEMMPNGGSLLTLTYYGAEQVMPHYNVMGVAKAALEASVKYIAEDLGK
LGIRCNAISAGPIKTLAASGIGDFRYIMKWNELNSPLRRNVTQEEVGKAALYLCSDLGSG
TTGENLHVDAGYHVVGMKAVDAPDIDVVTGRKD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacacccttatggccggcaaacgcgggctgatcatgggtctggcgaacgacaag
tcgatcgcctgggggatcgcgaaagcgctcggcaatgccggggcggagcttgcgttctcc
tatcagggcgaggcgctgaaaaagcgcgtcgaaccgctcgcggcccagcttggcagcgat
atcctggtcgaatgcgatgtcgccgatcagggctcgctcgataggctcttcgagacgctg
aaagagaaatggggcacgctcgatttcgtcgtccatgcgatcgggttctcggacaagaac
gagctgcgcggccgctatgtcgatacctcgcccgcgaatttcgcgatgacgatggatatt
tcggtctacagcttcaccgcggtgtgcaaacgcgccgccgagatgatgccgaatggcggc
tcgctcctgacgctgacctattacggcgccgagcaggtgatgccgcattacaacgtgatg
ggggtggccaaggccgcgctcgaggcgtcggtgaaatatatcgccgaggatctgggcaag
ctcggcatccgctgcaacgcgatctcggcgggcccgatcaagacgctcgcggcctcgggc
atcggcgatttccgctatatcatgaagtggaacgagctgaactcgcccttgcgccgcaat
gtgacgcaagaagaggtcggcaaggccgcgctctatctgtgctcggatctgggctcgggc
accaccggcgagaacctgcatgtcgatgcgggctatcatgtcgtcggcatgaaggcggtg
gatgcgcccgatatcgacgtggtcaccggccggaaggactga

DBGET integrated database retrieval system