KEGG   Rhodococcus sp. p52: IM25_03070Help
Entry
IM25_03070        CDS       T05434                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rhq  Rhodococcus sp. p52
Brite
KEGG Orthology (KO) [BR:rhq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    IM25_03070
Enzymes [BR:rhq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     IM25_03070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored AlaDh_PNT_C HI0933_like FAD_binding_3 NAD_binding_7 DAO NAD_binding_8 Thi4 K_oxygenase FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AOD20742
UniProt: A0A1B2U9D9
LinkDB All DBs
Position
complement(703989..705584)
Genome map
AA seq 531 aa AA seqDB search
MLDASLAAQLKSLLEKVPQPIELVSSLDDRPKSKELADLLDQIAGMSDLVTHVRDGEATR
LPSFLIRRVGTDIAVEFAGIPLGHEFTSLVLALLQVGGHPSKEAVELLEQVRDLEGDFHF
ETYFSLSCQNCPDVVQALNVMCVTNSRIKHTAIEGSLFQDEVDARQVMAVPTVFLNGELF
GSGRMNLEQIVGKLDSGSAERTAAAISEKDPFDVLVVGGGPAGATAAIYASRKGIRTGVL
AERFGGQVLDTMAIENFSSVPYTEGPKFAAELENHVRQYDVDIMNVQKASKLTPAPTEGG
LVEVELESGARLLSRSVVLATGARWRAMNVPGEQEYRNKGVTYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGVVAHVTLIEFDSVLRADEVLQRKLRSLPNVDIIVSALTTEVLGDG
SKVTGLTYTDRTTDESRTLELDGVFVQIGLLPNTEWLTGTVELSPRGEIVVDDHGRTSVP
GVFAAGDCTTVPYKQIIVSAGAGATAALGAFDHLIRTSAPAQAEEAVAATV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcctccctcgccgcccagttgaagtcccttctcgaaaaggtcccccagccg
atcgagctcgtgtcgtccctcgacgaccggccgaagtcgaaggaactcgccgatctcctc
gatcagatcgccggcatgtccgatctggtcacccatgtgcgcgacggtgaagccacccgt
ctcccctccttcctgatccgccgggtcggcaccgacatcgcggtcgagttcgcgggcatc
ccgctcggccacgagttcacctccctcgtgctcgccctgctgcaggtcggcggccacccc
tcgaaggaggccgtggagctgctcgagcaggtgcgcgacctcgagggcgacttccacttc
gagacctacttctcactgtcgtgccagaactgccccgacgtggtgcaggccctgaacgtg
atgtgtgtgaccaactcgcgcatcaagcacaccgcgatcgaaggctcgctcttccaggac
gaagtcgacgcacgccaggtgatggcagtgccgaccgtcttcctcaacggtgagctgttc
ggctccggacgcatgaacctcgagcagatcgtcggcaagctcgacagcggttccgccgag
cgcaccgccgccgcgatcagcgagaaggatcccttcgacgtcctcgtcgtcggtggcggc
cccgccggcgcgactgccgcgatctacgcctcccgcaagggaatccgcaccggcgttctc
gccgagcgcttcggtggccaggtgctcgacaccatggccatcgagaacttctcctccgtc
ccctacacggagggcccgaagttcgctgccgagctcgagaaccacgtccgccagtacgac
gtcgacatcatgaacgtccagaaggcctcgaagctcaccccggcccccaccgagggcggc
ctcgtcgaggtcgagctcgagagcggcgcccggttgctttcgcgcagcgtcgttctcgcg
accggtgcccgctggcgcgcgatgaacgtgccgggcgagcaggagtaccgcaacaagggc
gtcacctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtcatc
ggtggcggtaactccggtgtggaggccgcgatcgacctcgccggcgtcgtcgcccacgtg
accctcatcgagttcgactcggtcctgcgcgccgacgaggtgctgcagcgcaagctccgc
agcctgcccaacgtcgacatcatcgtcagcgccctcaccaccgaggtcctcggcgacggt
tcgaaggtcaccggcctgacctacaccgaccgcaccaccgacgagtcgcgcaccctcgag
ctcgacggcgtgttcgtccagatcggtctgctaccgaacaccgaatggctcaccggcacg
gtcgaactcagcccgcgcggcgagatcgtcgtcgacgaccacggccgcacctcggtgccc
ggcgtgttcgccgccggcgactgcacgaccgtcccgtacaagcagatcatcgtctccgca
ggtgcgggtgcgacggccgcgctcggcgcgttcgaccacctcatccgcacgagcgccccg
gcccaggccgaggaagcggtcgccgcgaccgtctaa

DBGET integrated database retrieval system