KEGG   Rhodococcus sp. p52: IM25_03815Help
Entry
IM25_03815        CDS       T05434                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
rhq  Rhodococcus sp. p52
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AOD20868
UniProt: A0A1B2U9N4
LinkDB All DBs
Position
complement(864902..865966)
Genome map
AA seq 354 aa AA seqDB search
MDLPVVPPLAPMLAKVSSTVPSQPEDGPDEWSYEPKWDGFRAIVFRDGDEVVLGSRGGKD
LVRYFPELADAARAELPRRCVVDGEIVVPREHDGRTRLDWQALSERIHPAASRVTMLAEQ
TPAVFVGFDLLALADENLMETPFAERRARLRSEIGGGKSCHVTVATTDTDPARRWFEEFE
GAGLDGVIAKRLDGLYVPDKREMLKLKHARTADCVLMGYRMHKSVEGIGSLLLGLYHDGE
LAMVGGASAFTRERREELLAELQPLRLGDDVVEQGEPTRWRSAVDRSWVPLRPERVVEVA
YDQMEGVSGAGMRFRHAAKFLRWRPDRDPESCTFDQLEVPVRYDLSDVLDRTED
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcctgtggtgccgccgctcgccccgatgctcgccaaggtctcctccaccgtc
ccctcccaacccgaagacggtcccgacgagtggtcctacgaacccaaatgggacggtttc
cgggcgatcgtcttccgcgacggtgacgaggtggttctcggctcgcgcggaggcaaggac
ctcgtgcgctacttcccggaactcgccgacgccgcgcgcgccgaactgccccgcaggtgc
gtggtcgacggggagatcgtcgtcccgcgcgaacacgacggccgcacccgactcgactgg
caggcgctgtccgagcggatccatccggccgccagccgggtcacgatgctcgccgagcag
acaccggccgtgttcgtcggtttcgatctgctcgctctcgccgacgagaatctcatggag
accccgttcgcggagcggcgcgcgcggctgcggtccgagatcggcggggggaagagctgt
catgtcacggtggccacgaccgacaccgatcccgcccgccgctggttcgaggagttcgaa
ggggccggcctcgacggcgtgatcgccaagcgactcgacgggctctatgtgcccgacaag
cgggagatgctcaagctcaaacatgcccgcaccgccgactgcgtcctcatgggctaccgc
atgcacaagagcgtcgagggcatcgggtcgttgctgctcgggctctatcacgacggcgaa
ctcgcgatggtcggcggagcctcggcgttcacgcgggagcggcgcgaggaactgctcgcc
gaactgcaaccgctgcgactcggggacgacgtcgtcgagcagggtgaaccgacgcggtgg
cgttcggcggtggaccgcagctgggtgccgttgcgtcccgaacgtgtcgtggaggtcgcg
tacgaccagatggaaggtgtgtcgggagcggggatgcggttccggcacgcagcgaagttc
ctgcggtggcgtcccgaccgtgaccccgagagctgcacgttcgaccagctggaggtgccg
gtgcgctacgacctgtcggatgtgctcgaccggacggaggactga

DBGET integrated database retrieval system