KEGG   Rhodococcus sp. p52: IM25_08900Help
Entry
IM25_08900        CDS       T05434                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rhq  Rhodococcus sp. p52
Pathway
rhq00250  Alanine, aspartate and glutamate metabolism
rhq00410  beta-Alanine metabolism
rhq00640  Propanoate metabolism
rhq00650  Butanoate metabolism
rhq01100  Metabolic pathways
rhq01120  Microbial metabolism in diverse environments
Module
rhq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rhq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    IM25_08900
   00650 Butanoate metabolism
    IM25_08900
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IM25_08900
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IM25_08900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhq01007]
    IM25_08900
Enzymes [BR:rhq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     IM25_08900
Amino acid related enzymes [BR:rhq01007]
 Aminotransferase (transaminase)
  Class III
   IM25_08900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOD21711
UniProt: A0A1B2UC29
LinkDB All DBs
Position
1925219..1926460
Genome map
AA seq 413 aa AA seqDB search
MARLSPRLLQATPVTVDHAEGCYIHGTDGRRYLDFTAGIGVTSTGHCHPHVVEAARRQIG
SLIHGQYTTVMHRPLLELTERLGTVLPEGLDSLFFANSGSEAVEAALRLARQATGRPGIV
VFHGGFHGRTVAAATMTTSGTRFSAGFSPLMGGVHVAPFPTAYRYGWSEEEATDFALQEL
DYLFATLVAPDEIAAFVVEPVLGEGGYVPGNTRFFQGLRQRADEHGILLVFDEIQTGFGR
TGKFFGHQHFDVRPDIITIAKGLASGFPLSGIAASEELMERARPGSQGGTYGANAVSCAA
AVATLDVIEKEGLVDNAAARGRELLSGARENTIDAIGDVRGLGLMVGLEFTTDGAPDRER
ASAAQQLAAQKGLLLLTCGAHMNVVRMIPPLIVTTRQIEDALGIWSEVLAEVR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtctttcaccccgcctgctgcaggcaacgcccgtcaccgtcgaccacgccgag
gggtgctacatccacggcaccgacggacgtcggtatctcgacttcaccgccggcatcggc
gtcacgagtaccggccactgtcacccgcacgtcgtcgaggccgcccgccggcagatcggc
tcgctgatccacgggcagtacacgaccgtgatgcaccggcccctgctcgaactcaccgaa
cgcctgggcacggtgctccccgaaggactcgactcgctgttcttcgccaattcgggcagc
gaggcagtcgaggcggcgctgcgtctggcccgccaggcgacagggcgacccggaatcgtc
gtcttccacggcggtttccacggccgtaccgtcgccgccgccacgatgaccacctccgga
acccgtttctccgcagggttctcgccgctcatgggcggtgtacacgtcgctcccttcccc
acggcctatcgctacggctggtcggaggaggaagcgaccgatttcgccctgcaggaactg
gactacctgttcgcgaccctcgtcgcgccggacgagatcgcggccttcgtcgtcgaaccg
gtcctgggcgagggcggttacgtccccggcaacaccaggttcttccagggactgcggcag
cgggccgacgaacacggcatcctgctcgtcttcgacgagatccagaccggattcgggcgg
accggaaagttcttcgggcatcagcacttcgacgtgcgacccgacatcatcacgatcgcc
aagggcctcgcgagcggtttcccgctgtcgggtatcgccgcctccgaggaactcatggag
cgcgcccgtccgggatcgcagggcggcacgtacggagctaatgcggtctcctgcgcggcg
gccgtggccactctcgacgtgatcgagaaggaggggctcgtcgacaacgccgccgcacgt
ggacgtgaactgctctccggtgcacgggagaacacgatcgacgccatcggcgacgtgcgc
ggcctcggcctcatggtgggcctcgagttcactaccgacggagcacccgaccgggagcgg
gcgtccgcagcgcagcagctcgccgcgcagaaggggttgctgctgttgacctgcggtgcg
cacatgaacgtggtgcgcatgatcccgccgctgatcgtcaccacccggcagatcgaggat
gcgctcgggatctggtccgaggtcctcgccgaggtccgataa

DBGET integrated database retrieval system